DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and elfn2

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001123827.1 Gene:elfn2 / 100170580 XenbaseID:XB-GENE-1001551 Length:806 Species:Xenopus tropicalis

Alignment Length:618 Identity:133/619 (21%)
Similarity:216/619 (35%) Gaps:179/619 (29%)


  Fly    27 LLLTLVILPPETTAFC------PSKCQCLGGEANS--RALCV--DAALEDVPIQLNPETKYINLT 81
            |.||.|..      ||      .|.|..:.||...  .|:|.  ....|.:|..:|.....:.|.
 Frog     6 LWLTTVFF------FCHLPTGARSDCWLIEGEKGYVWLAICSQNQPPYETIPQHINSTVHDLRLN 64

  Fly    82 VNRIRTLEF-SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145
            .|:::.:.: ||..:..|..|:|::|.|..:....|..||.|:.|.|..|.:::|.:...:|:..
 Frog    65 ENKLKIIGYSSLSRFGNLTDLNLTKNEIYYIEDGAFMGQSNLQILYLGYNKLTNLSEGMLRGMPR 129

  Fly   146 LLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPAS 210
            |..|.:..|.|:.|.|.|.|:..||:.:||::|.|.:|:.:.|.|:.||.|...         |.
 Frog   130 LQFLFVQHNLIDVVTPNAFSECLSLISIDLSSNRIKNLDSSTFAGLQTLMVCEL---------AG 185

  Fly   211 NLWHLHA-----LKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLD 270
            |.:|...     |:.|.|..|:   .||  |:.|:          ..:..:.:.|..|....|  
 Frog   186 NPFHCGCELYGFLEWLVMFNNV---TRN--FDRLQ----------CETPREFTGFPLLSPRPH-- 233

  Fly   271 LSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRID-SRAF- 333
            .|.|.:|::.    :...|..:|:|...|.:.|.|                 |.|...| |..| 
 Frog   234 HSRNAITVLQ----AHCRNGGHLHLPRERPTSLSA-----------------DSLHETDESSGFN 277

  Fly   334 -VDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPL 397
             .|....:|......|..|        |.|.|...::..||...:.:..:|   .||||:   .:
 Frog   278 AGDILSPETTTPTPTPDSS--------GGPTIDIHHVTGNSATLIVTIPYP---FQKLYV---LV 328

  Fly   398 QCNCSLLWLWRLVTGNFEGVDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYI 462
            |.|.|.::                                      :.|.:....:       ||
 Frog   329 QYNNSFVY--------------------------------------DVTTLKHKKE-------YI 348

  Fly   463 AEQHIVNALHTTEPSA-YELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCP 526
                   .|...:|.. |....:|      |....|....|.....::|..:.....:.   |..
 Frog   349 -------TLDKLKPHVNYTFCVTS------IRFSKRYNHTCLFLATRIRDEKDFAPSTS---TTT 397

  Fly   527 AHIVTVVCAVITCLLVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRILQGHNPGGL 591
            .:|:|    ::.||...:|.:.|:||   ..|::::..|:      |..:||...||:..    .
 Frog   398 HYIMT----ILGCLFGMVIILGVVYY---CLRKKRMQEEK------KKSLNVKKTILEMR----Y 445

  Fly   592 GLGMSMTLGGGNHVNGLGMTLNYPHHAQTLQAH 624
            |..:...||              ||.:|.|..|
 Frog   446 GSDVDPCLG--------------PHSSQKLSEH 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 4/23 (17%)
LRR_RI 79..327 CDD:238064 63/254 (25%)
leucine-rich repeat 98..121 CDD:275380 8/23 (35%)
LRR_8 120..180 CDD:290566 20/60 (33%)
leucine-rich repeat 122..145 CDD:275380 6/23 (26%)
leucine-rich repeat 146..169 CDD:275380 8/23 (35%)
LRR_8 169..228 CDD:290566 19/64 (30%)
leucine-rich repeat 170..193 CDD:275380 8/23 (35%)
leucine-rich repeat 194..217 CDD:275380 5/23 (22%)
LRR_8 218..276 CDD:290566 13/58 (22%)
leucine-rich repeat 218..265 CDD:275380 10/47 (21%)
LRR_RI <265..406 CDD:238064 32/144 (22%)
LRR_8 265..321 CDD:290566 10/56 (18%)
leucine-rich repeat 266..289 CDD:275380 4/23 (17%)
leucine-rich repeat 290..313 CDD:275380 5/23 (22%)
leucine-rich repeat 314..338 CDD:275380 6/27 (22%)
LRR_8 337..397 CDD:290566 13/60 (22%)
leucine-rich repeat 339..360 CDD:275380 3/21 (14%)
elfn2NP_001123827.1 LRR_RI <55..188 CDD:238064 41/142 (29%)
leucine-rich repeat 61..81 CDD:275378 4/20 (20%)
LRR_8 81..140 CDD:290566 17/59 (29%)
leucine-rich repeat 82..105 CDD:275378 8/23 (35%)
LRR_4 105..145 CDD:289563 11/40 (28%)
leucine-rich repeat 106..129 CDD:275378 6/23 (26%)
LRR_8 128..188 CDD:290566 22/69 (32%)
leucine-rich repeat 130..153 CDD:275378 8/23 (35%)
leucine-rich repeat 154..167 CDD:275378 5/13 (38%)
TPKR_C2 186..229 CDD:301599 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.