DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRC70

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_852607.3 Gene:LRRC70 / 100130733 HGNCID:35155 Length:622 Species:Homo sapiens

Alignment Length:643 Identity:156/644 (24%)
Similarity:246/644 (38%) Gaps:117/644 (18%)


  Fly    17 LCG---AIPVLLLLLLT---LVILPPETTAFCPSKCQ-CLGGEANSRALCVDAALEDVPIQLNPE 74
            :||   ::|.|.|.|:.   |::|..:....|.|.|| |.|.:.|    |.:..|..:|......
Human     1 MCGLQFSLPCLRLFLVVTCYLLLLLHKEILGCSSVCQLCTGRQIN----CRNLGLSSIPKNFPES 61

  Fly    75 TKYINLTVNRIRTL-EFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKH 138
            |.::.||.|.|..: |..|.....|..|.|..:.|..:..|.|.....|..|.|:.|.:..|...
Human    62 TVFLYLTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPG 126

  Fly   139 AFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNR 203
            .||||.||..|.|.:|::..|.....:||.|:..|:|..|.:..|....|.||..|.:|...||.
Human   127 IFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNN 191

  Fly   204 LLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKH 268
            :|.:..|...||..|..|.:..|.:..|.:::||.||.|..||:..|.:..:...||:||.:|::
Human   192 ILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEY 256

  Fly   269 LDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAF 333
            |.|.::.:..|.....|.::||.:|.|..|....|.:..|..|.:|..|.|.|...:. ||:..|
Human   257 LLLKNSRIRNVTRDGFSGINNLKHLILSHNDLENLNSDTFSLLKNLIYLKLDRNRIIS-IDNDTF 320

  Fly   334 VD-NTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPL 397
            .: ...|:.|:|:.|        .|...:|.:|:                |:..|..|....||.
Human   321 ENMGASLKILNLSFN--------NLTALHPRVLK----------------PLSSLIHLQANSNPW 361

  Fly   398 QCNCSLL----WL----------------------------------------WRLVTGNFEGVD 418
            :|||.||    ||                                        |.:|.      .
Human   362 ECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVK------S 420

  Fly   419 PGMEHAAGGAVAALAK-EADDEELADEATAVASTDDGVAALAA--YIAEQHIVNALHTTE--PSA 478
            |.:.|.....:.|..| ..:...|.:..|...:..:.:....|  :..|....|.|.||.  |..
Human   421 PHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQ 485

  Fly   479 YELATS---SSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPAHIVTVVCAVITCL 540
            .:|.||   :..:||.:........|          :..|:...|.|....|..:.:...::.|:
Human   486 IQLTTSVTLNLEKNSALPNDAASMSG----------KTSLICTQEVEKLNEAFDILLAFFILACV 540

  Fly   541 LVAMIGISVLYYLRFVK-----RRRKL----LHERGPMRTSKSIINVHDRILQGHNPG 589
            |:..:...|:.:.:.:|     |..:|    .::......:.||.|.....|:  :||
Human   541 LIIFLIYKVVQFKQKLKASENSRENRLEYYSFYQSARYNVTASICNTSPNSLE--SPG 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 7/23 (30%)
LRR_RI 79..327 CDD:238064 78/249 (31%)
leucine-rich repeat 98..121 CDD:275380 6/23 (26%)
LRR_8 120..180 CDD:290566 21/60 (35%)
leucine-rich repeat 122..145 CDD:275380 9/23 (39%)
leucine-rich repeat 146..169 CDD:275380 7/23 (30%)
LRR_8 169..228 CDD:290566 19/59 (32%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
leucine-rich repeat 194..217 CDD:275380 8/23 (35%)
LRR_8 218..276 CDD:290566 19/58 (33%)
leucine-rich repeat 218..265 CDD:275380 16/47 (34%)
LRR_RI <265..406 CDD:238064 38/146 (26%)
LRR_8 265..321 CDD:290566 16/56 (29%)
leucine-rich repeat 266..289 CDD:275380 5/23 (22%)
leucine-rich repeat 290..313 CDD:275380 7/23 (30%)
leucine-rich repeat 314..338 CDD:275380 7/25 (28%)
LRR_8 337..397 CDD:290566 12/60 (20%)
leucine-rich repeat 339..360 CDD:275380 5/21 (24%)
LRRC70NP_852607.3 LRRNT 31..62 CDD:214470 10/35 (29%)
LRR 1 61..82 7/21 (33%)
leucine-rich repeat 65..85 CDD:275380 6/20 (30%)
LRR_8 85..144 CDD:290566 20/59 (34%)
LRR 2 85..106 6/21 (29%)
leucine-rich repeat 86..109 CDD:275380 6/23 (26%)
LRR 3 109..130 7/21 (33%)
leucine-rich repeat 110..133 CDD:275380 9/23 (39%)
LRR_8 133..192 CDD:290566 20/59 (34%)
LRR 4 133..154 6/21 (29%)
leucine-rich repeat 134..157 CDD:275380 7/23 (30%)
LRR 5 157..178 6/21 (29%)
leucine-rich repeat 158..181 CDD:275380 7/23 (30%)
LRR_RI <159..340 CDD:238064 56/190 (29%)
LRR 6 181..202 6/21 (29%)
LRR_8 182..240 CDD:290566 20/58 (34%)
leucine-rich repeat 182..205 CDD:275380 8/23 (35%)
LRR 7 205..226 6/21 (29%)
leucine-rich repeat 206..229 CDD:275380 8/23 (35%)
LRR_8 228..288 CDD:290566 19/60 (32%)
LRR 8 229..250 6/21 (29%)
leucine-rich repeat 230..253 CDD:275380 8/23 (35%)
LRR 9 253..274 5/21 (24%)
leucine-rich repeat 254..277 CDD:275380 5/23 (22%)
LRR_8 277..337 CDD:290566 19/69 (28%)
LRR 10 277..298 7/21 (33%)
leucine-rich repeat 278..301 CDD:275380 7/23 (30%)
LRR 11 301..322 7/22 (32%)
leucine-rich repeat 302..326 CDD:275380 7/25 (28%)
LRR 12 326..347 7/45 (16%)
leucine-rich repeat 327..348 CDD:275380 8/45 (18%)
LRRCT 359..398 CDD:214507 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.