DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and lingo4a

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001076447.1 Gene:lingo4a / 100005227 ZFINID:ZDB-GENE-060503-275 Length:618 Species:Danio rerio

Alignment Length:382 Identity:116/383 (30%)
Similarity:176/383 (46%) Gaps:48/383 (13%)


  Fly    38 TTAFCPSKCQCLGGEANSRAL----CVDAALEDVPIQLNPETKYINLTVNRIRTLE----FSLPF 94
            |:..|..:|.|      |..|    |....|..||..:...|:.:|||.|.::||.    |||  
Zfish    38 TSGPCAQRCDC------SPKLPLVDCSSQQLSAVPEGVPDATQVLNLTYNHLKTLSSRQFFSL-- 94

  Fly    95 YMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETV 159
             .:|..||||.|::..:..:.|.....|.||.||||.:..:...||.||.|:..||:|.|.|..:
Zfish    95 -RQLRELDLSANMLTVIEVEAFVGLQNLITLRLSRNRLKIIPVGAFSGLPNVQFLDISENEILVL 158

  Fly   160 HPTALSDLASLVELDLTNNNIVSLEDNCFKGM-NTLEVLVFRNNRLLDVPASNLWHLHALKSLDM 223
            ......::.||.:|:.:.|::|.:.:..|.|: |.||:.:.|.| |..||:.....|..|:.|..
Zfish   159 LDDMFGEMPSLQKLEASENDLVFISNRAFSGLPNLLELRLERCN-LTTVPSEAFSRLTGLQHLRF 222

  Fly   224 SLNLVEFVRNDSFEGLKELLALSV-QGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKL 287
            ....:..:.|:||..|:.|..|.| :...:..|.:::..|| :|..|.||..||:.||...|..|
Zfish   223 CRLGLTALPNNSFRQLQRLQDLHVSRCPWLHTLAVNSLIGL-NLTSLTLSHCNLSAVPYAPLHHL 286

  Fly   288 SNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSD 352
            ..|.||:|..|..:.:.:....:|..|:||||.....| .::|.||.:....:.|::::      
Zfish   287 VYLRYLDLSYNPITTVLSGLLGDLLRLQELHLVSTGLL-HVESGAFRNLAFFRLLNVSD------ 344

  Fly   353 IPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQCNCSLLWLWR 408
                               |.|.||..:.| .|..|:.|.|..|||.|:|.|||:.|
Zfish   345 -------------------NRLVTLEESAFHAVGSLEVLRLDGNPLACDCRLLWVMR 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 10/26 (38%)
LRR_RI 79..327 CDD:238064 83/254 (33%)
leucine-rich repeat 98..121 CDD:275380 7/23 (30%)
LRR_8 120..180 CDD:290566 21/60 (35%)
leucine-rich repeat 122..145 CDD:275380 11/23 (48%)
leucine-rich repeat 146..169 CDD:275380 5/23 (22%)
LRR_8 169..228 CDD:290566 18/60 (30%)
leucine-rich repeat 170..193 CDD:275380 7/24 (29%)
leucine-rich repeat 194..217 CDD:275380 8/23 (35%)
LRR_8 218..276 CDD:290566 17/59 (29%)
leucine-rich repeat 218..265 CDD:275380 12/48 (25%)
LRR_RI <265..406 CDD:238064 43/142 (30%)
LRR_8 265..321 CDD:290566 21/56 (38%)
leucine-rich repeat 266..289 CDD:275380 10/23 (43%)
leucine-rich repeat 290..313 CDD:275380 6/23 (26%)
leucine-rich repeat 314..338 CDD:275380 9/24 (38%)
LRR_8 337..397 CDD:290566 12/61 (20%)
leucine-rich repeat 339..360 CDD:275380 1/21 (5%)
lingo4aNP_001076447.1 LRRNT 41..70 CDD:214470 9/35 (26%)
leucine-rich repeat 52..72 CDD:275380 5/20 (25%)
leucine-rich repeat 73..96 CDD:275380 10/26 (38%)
LRR_RI 88..380 CDD:238064 98/323 (30%)
LRR_8 95..155 CDD:290566 23/60 (38%)
leucine-rich repeat 97..120 CDD:275380 7/23 (30%)
leucine-rich repeat 121..144 CDD:275380 11/23 (48%)
leucine-rich repeat 145..168 CDD:275380 5/23 (22%)
leucine-rich repeat 169..192 CDD:275380 6/23 (26%)
LRR_8 191..250 CDD:290566 18/60 (30%)
leucine-rich repeat 193..216 CDD:275380 8/24 (33%)
leucine-rich repeat 217..240 CDD:275380 6/23 (26%)
leucine-rich repeat 241..288 CDD:275380 16/48 (33%)
LRR_8 264..323 CDD:290566 21/59 (36%)
leucine-rich repeat 289..310 CDD:275380 5/21 (24%)
LRR_8 312..371 CDD:290566 21/85 (25%)
leucine-rich repeat 313..336 CDD:275380 9/24 (38%)
leucine-rich repeat 337..356 CDD:275380 6/44 (14%)
I-set 428..512 CDD:254352
Ig 439..512 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128572
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.