DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snoo and SKIL

Sequence 1:NP_001097115.1 Gene:Snoo FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster
Sequence 2:NP_001234937.1 Gene:SKIL HGNCID:10897 Length:684 Species:Homo sapiens

Alignment Length:695 Identity:190/696 (27%)
Similarity:282/696 (41%) Gaps:184/696 (26%)


  Fly    13 LKKYQTS------ATKSLQGPGHALTTAG---VLDIVTNGRS--------------------ESP 48
            ::..||:      :||.|.|.|...:...   :.||..||::                    |:.
Human     1 MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETD 65

  Fly    49 GLNGK--CQASPPVVAL---IKKEI----------LSSPEPQDLHHHECSTRGTPPQIYSPATPP 98
            |.:.|  |.:.|..:.|   :|..:          |..|......|   |.....|.::.|...|
Human    66 GEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARH---SQESMSPTVFLPLPSP 127

  Fly    99 RELSQPILSVADAGCGELYETKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELG 163
            :.|..|:|..:|:.. ||.:|.|||::|.||.||||.||||||.||:||.:|:|:|||.:.|||.
Human   128 QVLPGPLLIPSDSST-ELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELY 191

  Fly   164 IYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHR---SDRNSYVPIES----LA 221
            ||||:||.|||...|...|||.:..:.||||.|||:|||.|||..   ....|.:|.:|    |.
Human   192 IYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLK 256

  Fly   222 KGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENHTCHWGFD 286
            :...:|.|.|:|.|||:|:..|..|......||:||||.|.|:||.||.|.||..:..||||||:
Human   257 ETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFE 321

  Fly   287 SRNWHDYLHV---ALDVENREKYQIILDQLKE-------------------VELKEMHKA-QREL 328
            |..||.||||   .|.....:|.:|||:::||                   :||:..:.. ::|.
Human   322 SAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEG 386

  Fly   329 EHKKRKAEML-------MDDGMLGSGPVLGLA----------------------GHPHG-LVGAL 363
            :|..:....|       |.|.::.....|..|                      .|..| |...:
Human   387 DHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKTV 451

  Fly   364 APPPPPPMKQPQMDIPSGKKQLQQLK-----------------------------GATVAASALE 399
            :.|.....:|.:||:.:.::...:|.                             |...|||:..
Human   452 SYPDVSLEEQEKMDLKTSRELCSRLDASISNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPL 516

  Fly   400 YQYQVMYAHCVQKEREREREHLPHSHPLPRQHRAVLVATTPYPHLPQYPTPPTLNSSSAFRPWGP 464
            ....|:   | :.::.:..|.:..:: |.:|.:..|:.                           
Human   517 LVKDVI---C-EDDKGKIMEEVMRTY-LKQQEKLNLIL--------------------------- 549

  Fly   465 DTTKAFLHAYGATLSSLPYACQEPPELQNPERVVRSTDKRYAERT---YQPNVALAPRKSILSK- 525
             ..|..|......|||.....:...|.||.::.:.|....:|:|.   |.....|..:...:.| 
Human   550 -QKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQKDLEKKLEQIMKQ 613

  Fly   526 --------ERDKDRERMEREVMERQRLREKETDHQVV--HIKQER 560
                    |:||:.|...:....||||...|.|.|.:  .::|||
Human   614 KCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQER 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SnooNP_001097115.1 Ski_Sno 114..207 CDD:280577 57/93 (61%)
c-SKI_SMAD_bind 226..317 CDD:198114 45/113 (40%)
SKILNP_001234937.1 Ski_Sno 136..235 CDD:280577 58/100 (58%)
c-SKI_SMAD_bind 261..356 CDD:198114 45/95 (47%)
GBP_C <524..672 CDD:303769 32/165 (19%)
coiled coil 639..650 CDD:293879 5/11 (45%)
coiled coil 661..672 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KYF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001690
OrthoInspector 1 1.000 T608999
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.