DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snoo and SKOR1

Sequence 1:NP_001097115.1 Gene:Snoo FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster
Sequence 2:NP_001352844.1 Gene:SKOR1 HGNCID:21326 Length:965 Species:Homo sapiens

Alignment Length:1318 Identity:252/1319 (19%)
Similarity:380/1319 (29%) Gaps:510/1319 (39%)


  Fly    13 LKKYQTSATKSLQGPG----HALTTAGVLDIVTNGRSESPGLNGKCQASPPVVALIKKEILSSPE 73
            |:.:.:..::|..|.|    .|...:|.::.:|.  ...||..|.                |||.
Human    12 LRIWVSLPSQSENGIGFLAARAFLRSGGMEALTT--QLGPGREGS----------------SSPN 58

  Fly    74 PQDLHHHECSTRGTPPQIYSPATPPRELSQPILSVADAGCGELYETKLEGKTIGCFSVGGEMRLC 138
                     |.:...|...|.|..|.::.               ||.|.|..|....:.|:.|||
Human    59 ---------SKQELQPYSGSSALKPNQVG---------------ETSLYGVPIVSLVIDGQERLC 99

  Fly   139 LPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCA 203
            |.|..|.:|.::|..:|:.....|||.|.|||..||...:.|..:|...:..|:||:.:|||||.
Human   100 LAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCK 164

  Fly   204 ALL--HRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQ 266
            :.|  |:..:   :| |:.|     |.|.|:|.....|...|..|:..:..||||..|..:|||.
Human   165 SFLGEHKPPK---LP-ENFA-----FDVVHECAWGSRGSFIPARYNSSRAKCIKCGYCSMYFSPN 220

  Fly   267 KFVGHVHRKFENHTCHWGFDSRNWHDYLHVALDVENREKYQIILDQLKEVELKEMHKAQRELEHK 331
            ||:.|.||.               .|..:...|..|...::      :.::|.: ..|..||.|.
Human   221 KFIFHSHRT---------------PDAKYTQPDAANFNSWR------RHLKLSD-KSATDELSHA 263

  Fly   332 KRKAEMLMDDGML----------GSGPVLGLAGHPHGLVGA-----------LAP---------- 365
            ....:.:.:.|..          |.|...|..|...|..|.           :||          
Human   264 WEDVKAMFNGGTRKRTFSLQGGGGGGANGGSGGQGKGGAGGGGGGGPGCGAEMAPGPPPHKSLRC 328

  Fly   366 -------PPPPPMKQPQMDI--------------PSGKKQLQQLKGATVAASALEYQYQVMYAHC 409
                   ||.||...||..:              |.|        ||.|.:      |.|:    
Human   329 GEDEAAGPPGPPPPHPQRGLGLATGASGPAGPGGPGG--------GAGVRS------YPVI---- 375

  Fly   410 VQKEREREREHLPHSHPLPRQHRAVLVATTP--YPHLPQYPT---------PPTLNSSSAFRPWG 463
                            |:|.:...:|....|  :||...:||         .|.|.:...  ..|
Human   376 ----------------PVPSKGFGLLQKLPPPLFPHPYGFPTAFGLCPKKDDPVLGAGEP--KGG 422

  Fly   464 PDTTKAFLHAYGATLSSLPYACQEPPEL-QNPERVVRSTDKRYAERTYQPNVALAPRKSILSKER 527
            |.|......|.....:..|.|...||.. ..|........       :||:.|.           
Human   423 PGTGSGGGGAGTGGGAGGPGASHLPPGAGAGPGGGAMFWG-------HQPSGAA----------- 469

  Fly   528 DKDRERMEREVMERQRLREKETDHQVVHIKQERSQTPTPPTASPPDGVVLPLDVVEPPHPSSSGS 592
             ||..                   .|.......:..||.|...|..| .||:    |.:|::...
Human   470 -KDAA-------------------AVAAAAAAATVYPTFPMFWPAAG-SLPV----PSYPAAQSQ 509

  Fly   593 NSPLPAHLPAAPATAPPNAGGAPPTPTNLRNMRSPEEFSAGGSNEITSSTS--PHHQQSSHHQVV 655
            ...:.|.:.||.|.|...||...|.|  |......:|...|......|:.|  |..:..:...:.
Human   510 AKAVAAAVAAAAAAAAAAAGSGAPEP--LDGAEPAKESGLGAEERCPSALSRGPLDEDGTDEALP 572

  Fly   656 QPTAGAPPPSQHIIATVNQHAKLLPSSSSLPNGNGSSSLAATNNEPSRIRINKNLMSQQPVV--- 717
            .|.|..|||                                   .|...|....:.:.:|||   
Human   573 PPLAPLPPP-----------------------------------PPPPARKGSYVSAFRPVVKDT 602

  Fly   718 -AVSGMTPHHHQHHPTHMHHFSHGYYKSQASSPTQSSSAGLNLSTHSSNVVSSPHHATQPKTHHS 781
             :::.:.....:           .|....|..|...:.:|..:|....:..||.:::..|     
Human   603 ESIAKLYGSARE-----------AYGAGPARGPGPGAGSGGYVSPDFLSEGSSSYNSASP----- 651

  Fly   782 SVGSGNHGLQNGKPHLGSEFELSTDTDDTDSLNGEPDSSAMLPPWEQAVESLRETRPKDRERVLL 846
                                    |.|..|    ||:                            
Human   652 ------------------------DVDTAD----EPE---------------------------- 660

  Fly   847 ILQRLLQENDQYRYNNIQLSELLHKQDAHIADLTEQLQRYRRQFEEQVCKVDLRKMPFKHQTRLE 911
                                                              ||             
Human   661 --------------------------------------------------VD------------- 662

  Fly   912 NVVEAGRGEAEEDEELEEDEMEDRANNNNQQELSPLIKAPANG----LRRSVTPPNCCAS-EGGD 971
              ||:.|...:||.               |:|..|  .||:.|    ..:...||:..:| ..|.
Human   663 --VESNRFPDDEDA---------------QEETEP--SAPSAGGGPDGEQPTGPPSATSSGADGP 708

  Fly   972 CEKPD--EPESKRIKLQVGE-----------KAEDKQVENEESPSNGTESHDLEK---------- 1013
            ...||  .|..:|   ::|.           .|||.....|.||.:|...::|.:          
Human   709 ANSPDGGSPRPRR---RLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELREPCGPLGGPAP 770

  Fly  1014 ----LEKNDDKTDPTNNPKSPQPSQISSDDEMEEDDEDEDEEDEDEEVQVEAPHSSALATPPTAT 1074
                ..:.|:..........|..|.:.:.:..|.|.||.....:|.|.:...|...:::.|..|.
Human   771 AKVFAPERDEHVKSAAVALGPAASYVCTPEAHEPDKEDNHSPADDLETRKSYPDQRSISQPSPAN 835

  Fly  1075 TPLSPDSAATAGQLFDSSNSSDESSMKKAQMSACHALEKMSSNVGSDENNQRLAE---------- 1129
            |....|     |...|              ::..|.:||...|:..:|..:.|.|          
Human   836 TDRGED-----GLTLD--------------VTGTHLVEKDIENLAREELQKLLLEQMELRKKLER 881

  Fly  1130 --ESQEDEAEEDPEEEDSDDDEMPLQQRQ-----------QQQRQRVAPQNVLSGPSVAGHH--- 1178
              :|.:|..::..:.|.:..:|| :||.|           |:::.|.|.|..|.....|.||   
Human   882 EFQSLKDNFQDQMKRELAYREEM-VQQLQIVRDTLCNELDQERKARYAIQQKLKEAHDALHHFSC 945

  Fly  1179 --PAPAH--------PPM 1186
              ..|.|        ||:
Human   946 KMLTPRHCTGNCSFKPPL 963

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SnooNP_001097115.1 Ski_Sno 114..207 CDD:280577 35/95 (37%)
c-SKI_SMAD_bind 226..317 CDD:198114 23/91 (25%)
SKOR1NP_001352844.1 Ski_Sno 75..168 CDD:308187 35/108 (32%)
c-SKI_SMAD_bind 180..272 CDD:198114 29/119 (24%)
DNA_pol3_gamma3 <659..846 CDD:331207 46/305 (15%)
PKK 854..>935 CDD:315199 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3810
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.