DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snoo and Ski

Sequence 1:NP_001097115.1 Gene:Snoo FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster
Sequence 2:NP_035515.2 Gene:Ski MGIID:98310 Length:727 Species:Mus musculus

Alignment Length:1015 Identity:237/1016 (23%)
Similarity:361/1016 (36%) Gaps:359/1016 (35%)


  Fly     7 PMISTVLKKYQTSATKSLQGPGHALTTAGVLDIVTNGRSESPGLNGKCQASPPVVALIKKEILSS 71
            |.:...|:::..|:..||.||. |.:.....:......::..|           .|.:...:.::
Mouse    15 PGLQKTLEQFHLSSMSSLGGPA-AFSARWAQEAYKKESAKEAG-----------AATVPAPVPTA 67

  Fly    72 PEPQDLHHHECSTRGTPPQIYSPA--TPPRELSQPILSVADAGCGELYETKLEGKTIGCFSVGGE 134
            .||             ||.::.||  .||..|..|....:|... |..||.|||:||.||.||||
Mouse    68 AEP-------------PPVLHLPAIQPPPPVLPGPFFMPSDRST-ERCETVLEGETISCFVVGGE 118

  Fly   135 MRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAE 199
            .||||||.||:||.||||:|||.:.|||.||||:||.|||...|...|||....:.||||:||||
Mouse   119 KRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAE 183

  Fly   200 RLCAALLHRSDRNSYVP------IESLAKG----ALSFHVYHKCFGKCEGICTPDMYSYQKPTCI 254
            |||.|||:   ..:|.|      ..|||.|    ..|..|||:|||||:|:..|::||.....||
Mouse   184 RLCNALLY---GGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACI 245

  Fly   255 KCLECDGWFSPQKFVGHVHRKFENHTCHWGFDSRNWHDYLHVALDVENREKYQII---LDQLKEV 316
            :||:|...:.|.|||.|.|:..||.||||||||.||..|:.::.|...:|:...:   ||.:|| 
Mouse   246 QCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKE- 309

  Fly   317 ELKEMHKAQRELEHKKRKAEMLMDDGMLGSGPVLGLAGHPHGLVGALAPPPPPPMKQPQMDIPSG 381
                  |.....::|:|...:                            ..||...:|:.|..|.
Mouse   310 ------KFDYANKYKRRVPRV----------------------------SEPPASIRPKTDDTSS 340

  Fly   382 K--------KQLQQLKGATVAASALEYQYQVMYAHCVQKEREREREHLPHSHPLPRQHRAVLVAT 438
            :        ||...|:  |:|.|:                    .:.|..:||..|         
Mouse   341 QSPASSEKDKQSTWLR--TLAGSS--------------------NKSLGCTHPRQR--------- 374

  Fly   439 TPYPHLPQYPTPPTLNSSSAFRPWGPDTTKAFLHAYGATLSSLPYACQEPPELQNPERVVRSTDK 503
                             .||||||.|                   |.....:..:|.......|.
Mouse   375 -----------------LSAFRPWSP-------------------AVSASEKETSPHLPALIRDS 403

  Fly   504 RYAERTYQ----PNVALAPRKSILSKERDKDRERMEREVMERQRLREKETDHQVVHIKQERSQTP 564
            .|:.::::    |||||||                             .|..:||:         
Mouse   404 FYSYKSFETAVAPNVALAP-----------------------------PTQQKVVN--------- 430

  Fly   565 TPPTASPPDGVVLPLDVVEPPHPSSSGSNSPLPAHLPAAPATAPPNAGGAPPTPTNLRNMRSPEE 629
                 |||...|:                                              .|:|| 
Mouse   431 -----SPPCTTVV----------------------------------------------SRAPE- 443

  Fly   630 FSAGGSNEITSSTSPHHQQSSHHQVVQPTAGAPPPSQHIIATVNQHAKLLPSSSSLPNGNGSSSL 694
                   .:|:...|..:     ::...|||||.             .|.|.:::..:.:..:.:
Mouse   444 -------PLTTCIQPRKR-----KLTLDTAGAPD-------------MLTPVAAAEEDKDSEAEV 483

  Fly   695 AATNNEPSRIRINKNLMSQQPVVAVSGMTPHHHQHHPTHMHHFSHGYYKSQASSPT-QSSSAGLN 758
            ...:.|                                   .|:...  |..|||: .|||:..:
Mouse   484 EVESRE-----------------------------------EFTSSL--SSLSSPSFTSSSSAKD 511

  Fly   759 LST---HSSNVVS--SPHHATQPKTHHSSVGSGNHGLQNGKPHLGSEFELSTDTDDTDSLNGEPD 818
            ||:   |:..||:  :..|...|.           ||:....||....|...||.:..       
Mouse   512 LSSPGMHAPPVVAPDAAAHVDAPS-----------GLEAELEHLRQALEGGLDTKEAK------- 558

  Fly   819 SSAMLPPWEQAVESLRETRPKDRERVLLILQRLLQENDQYRYNNIQLSELLHKQDAHIADLTEQL 883
                    |:.:..:.:.|.|..|::...||.....:.:..:..:...|.|.:.......|.:::
Mouse   559 --------EKFLHEVVKMRVKQEEKLTAALQAKRSLHQELEFLRVAKKEKLREATEAKRSLRKEI 615

  Fly   884 QRYRRQFEEQVCKVDLRKMPFKHQTRLENVV-------EAGRGEAEEDEELEE----------DE 931
            :|.|.:.|:::.:.:..::..|.:......|       ||||..|:...::|:          |.
Mouse   616 ERLRAENEKKMKEANESRVRLKRELEQARQVRVCDKGCEAGRLRAKYSAQIEDLQAKLQHAEADR 680

  Fly   932 MEDRANNNNQQELSPLIKAPANGLRRSVTPPNCCASEGGD 971
            .:.||:...::|....::.....|:..:.|.......||:
Mouse   681 EQLRADLLREREAREHLEKVVRELQEQLRPRPRPEHPGGE 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SnooNP_001097115.1 Ski_Sno 114..207 CDD:280577 61/93 (66%)
c-SKI_SMAD_bind 226..317 CDD:198114 43/94 (46%)
SkiNP_035515.2 Ski_Sno 92..190 CDD:280577 61/99 (62%)
c-SKI_SMAD_bind 219..311 CDD:285935 43/99 (43%)
BAR <542..604 CDD:299863 13/77 (17%)
YscO 562..698 CDD:284686 23/136 (17%)
DUF4200 595..701 CDD:290574 18/106 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KYF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001690
OrthoInspector 1 1.000 T615818
orthoMCL 1 0.900 OOG5_133622
Panther 1 1.100 O PTHR10005
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4926
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.