DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snoo and skilb

Sequence 1:NP_001097115.1 Gene:Snoo FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster
Sequence 2:NP_001124141.1 Gene:skilb ZFINID:ZDB-GENE-080723-40 Length:629 Species:Danio rerio

Alignment Length:660 Identity:176/661 (27%)
Similarity:254/661 (38%) Gaps:201/661 (30%)


  Fly    52 GKCQASPPVVALIKKEI----LSSPEPQDLHHHECSTRGTPPQIYSPATPPRELSQPI------- 105
            ||.:|:|.:...:|..:    |||         :||..|  |..::......:|:.|:       
Zfish    57 GKAEANPDLSPGLKHTLAQFSLSS---------QCSLGG--PAAFTSHHGQYKLAPPLAHGGIAG 110

  Fly   106 --LSVADAGCGELYETKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQ 168
              |.|......:|....|||::|.|||||||:||||||.||.:|.||||:|||.:.|:|.:|||:
Zfish   111 GPLLVPPDSSTDLSMCSLEGESISCFSVGGELRLCLPQLLNTILRDFSLQQINSVCDQLYLYCSR 175

  Fly   169 CTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPI-----ESLAKGALSFH 228
            |...||...|...|||....:.||||.|||:|||..|||..:.    |:     |...:.:..|.
Zfish   176 CDATQLHILKVLGILPPGTPSCGLITLTDAQRLCNTLLHPGEE----PLDREQEEKDGEESGGFW 236

  Fly   229 VYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENHTCHWGFDSRNWHDY 293
            |.|:|.|||:|:..|.:||.....|::|.:|...|..::||.|.||:.:..||||||||..|..|
Zfish   237 VEHQCLGKCQGLFVPQLYSSPDAPCVRCSQCRMLFCTERFVMHSHRQPDKRTCHWGFDSAKWACY 301

  Fly   294 LHVA---LDVENREKYQIILDQLKEVELKEMHKAQRELEHKKR---------------------K 334
            |.:|   |...:.||.|..|:.:|.       |.|:|    ||                     |
Zfish   302 LQLAQRHLGTADEEKLQQSLEDMKA-------KFQQE----KRQPHVGVSSPAFVFDSRLLAGLK 355

  Fly   335 AEMLMDDGMLGS-------GPV-LGLAGH----PHGLVGALAPPPPPPMK--------------- 372
            .|...||.|..|       .|. .|||.|    |...:|:    |...|:               
Zfish   356 EEPSNDDLMWQSWYQYTHDKPAGNGLAQHSGCVPEKEMGS----PGTEMQTDTQDEKNQDAHDTD 416

  Fly   373 -----------------------QPQMDIPSGKKQLQQLKGATVAASALEYQYQ------VMYAH 408
                                   |...|.|..|:.::..|...|......|..|      .:|. 
Zfish   417 TKTLTFTGQEKSVQSDDGSADEWQRMADSPDCKRSVEHSKDNMVMELLQMYSAQHDKLQSTLYR- 480

  Fly   409 CVQKEREREREHLPHSHPLPR--QHRAVLVATTPYPHLPQYPTPPTLNSSSAFRPWGPDTTKAFL 471
              ||:.|:|.:.|.....|.|  .|..:....|.                               
Zfish   481 --QKQLEKELQALRQGETLDRCDLHGELEAVQTE------------------------------- 512

  Fly   472 HAYGATLSSLPYACQEPPELQNPERVVRS----------TDKRYAERTYQPNVALAPRKSILSKE 526
            ||            |...|:|..:|.::|          ..|:.:..|:|..: .|.:.|.|.:.
Zfish   513 HA------------QRLGEVQQEQRKLKSRLDQLRQQECRCKQLSTETHQETI-YARQLSELRQR 564

  Fly   527 RDK---DRERMEREVMERQRLREKETDHQVVHIKQERSQTPTPPTASPPDGVVLPLDVVEPPHPS 588
            .|:   |||.::.|:...:..||: .:..:..:||:..::..|...          |.::.|..|
Zfish   565 LDRAEEDREELQEELRREREARER-LERTISELKQQMRESTHPAQH----------DSMDSPSSS 618

  Fly   589 SSGSNSPLPA 598
            |.......||
Zfish   619 SYSDTHMSPA 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SnooNP_001097115.1 Ski_Sno 114..207 CDD:280577 52/93 (56%)
c-SKI_SMAD_bind 226..317 CDD:198114 38/94 (40%)
skilbNP_001124141.1 Ski_Sno 115..214 CDD:280577 53/99 (54%)
c-SKI_SMAD_bind 234..329 CDD:198114 39/102 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KYF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001690
OrthoInspector 1 1.000 T596555
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10005
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.