powered by:
Protein Alignment Cpr65Ay and Cpr100A
DIOPT Version :9
| Sequence 1: | NP_001097524.1 |
Gene: | Cpr65Ay / 5740348 |
FlyBaseID: | FBgn0085300 |
Length: | 109 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_651829.1 |
Gene: | Cpr100A / 43657 |
FlyBaseID: | FBgn0039805 |
Length: | 241 |
Species: | Drosophila melanogaster |
| Alignment Length: | 100 |
Identity: | 26/100 - (26%) |
| Similarity: | 37/100 - (37%) |
Gaps: | 30/100 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 ITALIALVSS---------ASLEKGER----EEKLHFGFHTENGHQRNEAITYTVKPETVQDPKE 61
:|.|:||.|| |::...:| :.|....:..|:| ...|.||..|...
Fly 7 LTTLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDG--------INFKEETDADGTR 63
Fly 62 VTTQKPVEYKGGYSFISADGYEYQVLYKANKNGFQ 96
.|.||::...|....:.|.|.|||||
Fly 64 ---------HGSYSYLDPTGQRRTISYTAGKNGFQ 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.