DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ay and CG15515

DIOPT Version :9

Sequence 1:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:48/121 - (39%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQVFLITALIALV---SSASL-------------EKGEREEKLHFGFHTENGHQRNEAITYTVKP 53
            :::.|.|||:||:   |||.|             .:...:|...|.....||.:|.|.       
  Fly     4 AKLLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEM------- 61

  Fly    54 ETVQDPKEVTTQKPVEYKGGY-SFISADGYEYQVLYKANKNGFQPYVTAHKIKPDK 108
            ..:.:|.  |..:.:...|.| |:......|...:|.|:|:|   |...::||..|
  Fly    62 GVIMNPG--TPDEQLVVMGMYSSYDEKTDTETVTMYTADKDG---YKARYQIKNRK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AyNP_001097524.1 Chitin_bind_4 32..95 CDD:278791 14/63 (22%)
CG15515NP_001263088.1 Chitin_bind_4 46..102 CDD:278791 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.