DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ay and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster

Alignment Length:100 Identity:28/100 - (28%)
Similarity:45/100 - (45%) Gaps:17/100 - (17%)


  Fly    11 TALIALVSSASLEKGER----EEKLHFGFHTENGHQRNEAITYTVKPETVQDPKEVTTQKPV--E 69
            |:.....::|::.|.:.    :...:..:.|.|| .|.|.|.|..|   :..||..|:...|  |
  Fly    29 TSAATTTTAATIVKQDNVNNADGSFNSSYETSNG-IRVENIGYLKK---IIVPKTETSDGQVIDE 89

  Fly    70 YK-------GGYSFISADGYEYQVLYKANKNGFQP 97
            ::       |.||:...||....:.|.|::|||||
  Fly    90 HEELVLVQTGSYSYSDPDGNLITLRYVADENGFQP 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr65AyNP_001097524.1 Chitin_bind_4 32..95 CDD:278791 21/71 (30%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.