DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ay and Cpr12A

DIOPT Version :10

Sequence 1:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:107 Identity:23/107 - (21%)
Similarity:44/107 - (41%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLSQVFLITALIALVSSASLEKGEREEKL-------------HFGFHTENGHQRNEAITYTVKPE 54
            :|..:||::|  .|:|:..:::.....:|             .:.|..::|..|.|. .|.||  
  Fly     7 ILFAIFLLSA--TLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYER-GYFVK-- 66

  Fly    55 TVQDPKEVTTQKPVEYKGGYSFISADGYEYQVLYKANKNGFQ 96
                   :...|.:...|.|::...||....|.|.|::.|::
  Fly    67 -------INDVKTLMVVGYYAYRMTDGRYITVFYNADQFGYR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AyNP_001097524.1 Chitin_bind_4 33..95 CDD:459790 15/61 (25%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 15/63 (24%)

Return to query results.
Submit another query.