powered by:
                   
 
    
    
             
          
            Protein Alignment Cpr65Ay and Cpr12A
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001097524.1 | Gene: | Cpr65Ay / 5740348 | FlyBaseID: | FBgn0085300 | Length: | 109 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_572896.1 | Gene: | Cpr12A / 32309 | FlyBaseID: | FBgn0030494 | Length: | 173 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 107 | Identity: | 23/107 - (21%) | 
          
            | Similarity: | 44/107 -  (41%) | Gaps: | 25/107 - (23%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     3 LLSQVFLITALIALVSSASLEKGEREEKL-------------HFGFHTENGHQRNEAITYTVKPE 54:|..:||::|  .|:|:..:::.....:|             .:.|..::|..|.|. .|.||
 Fly     7 ILFAIFLLSA--TLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYER-GYFVK-- 66
 
 
  Fly    55 TVQDPKEVTTQKPVEYKGGYSFISADGYEYQVLYKANKNGFQ 96:...|.:...|.|::...||....|.|.|::.|::
 Fly    67 -------INDVKTLMVVGYYAYRMTDGRYITVFYNADQFGYR 101
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR10380 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.