DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Ccp84Ab

DIOPT Version :8

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster

Alignment Length:272 Identity:56/272 - (20%)
Similarity:89/272 - (32%) Gaps:87/272 - (31%)


  Fly    11 FVFVL-----ITKVYAALSNPLSSKIEVY----------NQPEVTPEKERAKVRNYFVHEPYGPN 60
            |||.|     .:..||.::.|     :||          :.|....:|...|..     |.|.|:
  Fly     5 FVFALAFVAVASAGYAPIAAP-----QVYHAAPAVATYAHAPVAVAQKVVVKAA-----EEYDPH 59

  Fly    61 -TYSFGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFK 123
             .|.|.|.::|..|.:::.:.|:|  :|. ::|.|.....||.....:|.|....|::|.:.   
  Fly    60 PQYRFSYGVDDKLTGDNKGQVEER--DGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVN--- 119

  Fly   124 AGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHID 188
             .:..||:                               |.|:.|...||..:.|.....:.|  
  Fly   120 -REPLVKA-------------------------------VAVAPVVKTVAAPVAQYAAPAVAH-- 150

  Fly   189 VTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATT--------AEPQKT 245
                ...|||:..:   .|........::....|:..:..||...|..|.|        |.|..|
  Fly   151 ----YAAPAVVKTV---APVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHYAAPAHYAAPAAT 208

  Fly   246 ESS------KYH 251
            .:|      .||
  Fly   209 YTSYSAPAVAYH 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 14/51 (27%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.