DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr76Bc

DIOPT Version :8

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster

Alignment Length:294 Identity:64/294 - (21%)
Similarity:105/294 - (35%) Gaps:88/294 - (29%)


  Fly    29 SKIEVYNQPEVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSY 93
            |.:.|.::.:.|.|        |..|  |....|:|.|.:.|..|.:.:.:.|.|..:| ::|.|
  Fly    33 SPVVVIDEDDETME--------YAPH--YEHQGYAFSYGVKDLHTGDVKSQWESRDGDG-VKGHY 86

  Fly    94 GYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAPSNITWDPK 158
            ....|||.|....|.|....|::|          .||:|.....|              ||..|:
  Fly    87 SVLEPDGSIRTVHYTADAKKGFNA----------IVKTVGANSHP--------------ITESPE 127

  Fly   159 SHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPI 223
            ..     :.|.|..:|.....:..|..||.::.|:            :|.| ||:::|...| |.
  Fly   128 GS-----NQVNDDTSQSKINHYSKDQEHIVLSSDI------------KPLK-RPIEDLTHSH-PK 173

  Fly   224 VPF-----------QLPADQETTKATTAEPQKTESSKYHRAQSNNAEKAQQVEEPEARLPPPGPL 277
            ||.           |:|.|.:  .......|:...:.|.:..:     |.::|:...:|.|    
  Fly   174 VPSLIEIKPHARIKQVPMDMD--PGIRDRLQQARDTYYKQIAA-----AHKLEDYSQKLQP---- 227

  Fly   278 VNSSPSDGNWQRRTIEANRREFLANLPNLSEARP 311
             ..:..:|:|         :..:.|.|  .|.||
  Fly   228 -TYAVQEGDW---------KAVIVNEP--KEYRP 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 16/50 (32%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.