| Sequence 1: | NP_001097548.1 | Gene: | CG34462 / 5740319 | FlyBaseID: | FBgn0085491 | Length: | 312 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097644.1 | Gene: | Cpr76Bc / 40122 | FlyBaseID: | FBgn0036880 | Length: | 424 | Species: | Drosophila melanogaster | 
| Alignment Length: | 294 | Identity: | 64/294 - (21%) | 
|---|---|---|---|
| Similarity: | 105/294 - (35%) | Gaps: | 88/294 - (29%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    29 SKIEVYNQPEVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSY 93 
  Fly    94 GYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAPSNITWDPK 158 
  Fly   159 SHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPI 223 
  Fly   224 VPF-----------QLPADQETTKATTAEPQKTESSKYHRAQSNNAEKAQQVEEPEARLPPPGPL 277 
  Fly   278 VNSSPSDGNWQRRTIEANRREFLANLPNLSEARP 311 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG34462 | NP_001097548.1 | Chitin_bind_4 | 62..113 | CDD:278791 | 16/50 (32%) | 
| Cpr76Bc | NP_001097644.1 | Chitin_bind_4 | 56..108 | CDD:278791 | 16/52 (31%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12236 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||