powered by:
                   
 
    
    
             
          
            Protein Alignment CG34462 and Cpr66D
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001097548.1 | Gene: | CG34462 / 5740319 | FlyBaseID: | FBgn0085491 | Length: | 312 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_729400.1 | Gene: | Cpr66D / 38990 | FlyBaseID: | FBgn0052029 | Length: | 270 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 128 | Identity: | 36/128 - (28%) | 
          
            | Similarity: | 55/128 -  (42%) | Gaps: | 24/128 - (18%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    60 NTYSFGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFK 123::|.||:::.|.:..|.|.|:|.|  :|| |:|||.....||.|...||.|....|:.|:: |.:
 Fly   156 SSYQFGFDVKDDEFTNYQNRKEIR--DGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEV-IRE 217
 
 
  Fly   124 AGDEKVKSVWPTERPDIL------VERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQH 180..|..||...|.....:|      .::..|..||...:              .|..||.:.|:
 Fly   218 PTDIVVKIPTPPPPTQLLRAGGHKAQQEYSSGPSKQQY--------------QHQQQQQQPQY 266
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR12236 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.