DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr66D

DIOPT Version :8

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster

Alignment Length:140 Identity:34/140 - (24%)
Similarity:53/140 - (37%) Gaps:48/140 - (34%)


  Fly    60 NTYSFGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQI---- 119
            ::|.||:::.|.:..|.|.|:|.|  :|| |:|||.....||.|...||.|....|:.|::    
  Fly   156 SSYQFGFDVKDDEFTNYQNRKEIR--DGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREP 218

  Fly   120 --------------QIFKAGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVAD 170
                          |:.:||..|             .::..|..||...:              .
  Fly   219 TDIVVKIPTPPPPTQLLRAGGHK-------------AQQEYSSGPSKQQY--------------Q 256

  Fly   171 HVAQQLKQQH 180
            |..||.:.|:
  Fly   257 HQQQQQQPQY 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 21/51 (41%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.