powered by:
Protein Alignment CG34462 and Cpr56F
DIOPT Version :8
Sequence 1: | NP_001097548.1 |
Gene: | CG34462 / 5740319 |
FlyBaseID: | FBgn0085491 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611470.1 |
Gene: | Cpr56F / 37299 |
FlyBaseID: | FBgn0034499 |
Length: | 217 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 37/73 - (50%) |
Gaps: | 4/73 - (5%) |
Fly 55 EPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQ-GSYGYARPDGRIEVTKYMAKEDGGYSAQ 118
|.|||..|.|.|::.|.::.|.....|.| :|.:. |.|....||||.::.:|.| :..||...
Fly 121 EQYGPAKYEFKYDVQDYESGNDFGHMESR--DGDLAVGRYYVLLPDGRKQIVEYEA-DQNGYRPT 182
Fly 119 IQIFKAGD 126
|:..:.|:
Fly 183 IRYEQVGN 190
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR12236 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.