DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr56F

DIOPT Version :8

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster

Alignment Length:73 Identity:24/73 - (32%)
Similarity:37/73 - (50%) Gaps:4/73 - (5%)


  Fly    55 EPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQ-GSYGYARPDGRIEVTKYMAKEDGGYSAQ 118
            |.|||..|.|.|::.|.::.|.....|.|  :|.:. |.|....||||.::.:|.| :..||...
  Fly   121 EQYGPAKYEFKYDVQDYESGNDFGHMESR--DGDLAVGRYYVLLPDGRKQIVEYEA-DQNGYRPT 182

  Fly   119 IQIFKAGD 126
            |:..:.|:
  Fly   183 IRYEQVGN 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 16/51 (31%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.