powered by:
Protein Alignment CG34462 and Cpr50Ca
DIOPT Version :9
Sequence 1: | NP_001097548.1 |
Gene: | CG34462 / 5740319 |
FlyBaseID: | FBgn0085491 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610899.1 |
Gene: | Cpr50Ca / 36523 |
FlyBaseID: | FBgn0033867 |
Length: | 815 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 22/58 - (37%) |
Similarity: | 31/58 - (53%) |
Gaps: | 1/58 - (1%) |
Fly 62 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 119
|.|||.|.|..|.|....::.|.::|..:|.|....|||||:...|.| :|.|:.|.:
Fly 751 YEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHA-DDTGFHADV 807
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.