DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr35B

DIOPT Version :8

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster

Alignment Length:80 Identity:19/80 - (23%)
Similarity:32/80 - (40%) Gaps:8/80 - (10%)


  Fly    54 HEPYGPN-------TYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKE 111
            |:.:|.:       .|.|.|.:.|.:|.:.:.:.|.|. ..::.|.|.....||......|.|.:
  Fly    57 HDHHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRH-GHTVTGHYELIDADGHKRTVHYTADK 120

  Fly   112 DGGYSAQIQIFKAGD 126
            ..|:.|.:...|..|
  Fly   121 HKGFEAHVHREKLHD 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 13/50 (26%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.