| Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011985.1 | Gene: | TOM71 / 856517 | SGDID: | S000001159 | Length: | 639 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 239 | Identity: | 56/239 - (23%) |
|---|---|---|---|
| Similarity: | 93/239 - (38%) | Gaps: | 59/239 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 ELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVS 90
Fly 91 TTTFRRGKAKRALINTNQFTFMRQIDSEPDD---RVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
Fly 153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
Fly 218 --EPNFEYSV-------DRA-------RRFNRSDADFIDEFLDK 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 16/61 (26%) |
| TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 166..197 | CDD:276809 | 7/30 (23%) | ||
| TOM71 | NP_011985.1 | 3a0801s09 | 9..636 | CDD:273380 | 56/239 (23%) |
| TPR repeat | 127..155 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 160..190 | CDD:276809 | 7/30 (23%) | ||
| TPR repeat | 195..218 | CDD:276809 | 7/22 (32%) | ||
| TPR repeat | 345..373 | CDD:276809 | |||
| TPR repeat | 378..406 | CDD:276809 | |||
| TPR repeat | 411..441 | CDD:276809 | |||
| TPR repeat | 446..471 | CDD:276809 | |||
| TPR repeat | 480..508 | CDD:276809 | |||
| TPR repeat | 513..559 | CDD:276809 | |||
| TPR repeat | 564..588 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 2 | 1.870 | |||||