DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and TOM70

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_014278.3 Gene:TOM70 / 855602 SGDID:S000005065 Length:617 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:45/192 - (23%)
Similarity:86/192 - (44%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NKTDSSKKR-QKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVL 124
            |:....::| :|:||..|:.|  .|:.|...|.     .||::...:|...:....:.|||....
Yeast    30 NQLQQQQQRGKKNTINKDEKK--DTKDSQKETE-----GAKKSTAPSNPPIYPVSSNGEPDFSNK 87

  Fly   125 AR---EQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLG 186
            |.   |:::..|...:..||..:|...:..|..||:..:: :|:.||.|.|.:.|::.:.:.| .
Yeast    88 ANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLK-K 150

  Fly   187 IIDCDYVLAKIDEHYLRAWLYRAAAYKRLND--EPNFEYSVDRARRFNRSDADFIDEFLDKM 246
            :::......::...|.:..|.||:|.:.|..  :..|:.||      ...:.||.|..::.|
Yeast   151 VVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSV------LSLNGDFNDASIEPM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 14/61 (23%)
TPR repeat 133..161 CDD:276809 7/27 (26%)
TPR repeat 166..197 CDD:276809 6/30 (20%)
TOM70NP_014278.3 3a0801s09 1..614 CDD:273380 45/192 (23%)
TPR repeat 99..127 CDD:276809 7/27 (26%)
TPR repeat 131..161 CDD:276809 6/30 (20%)
TPR repeat 166..189 CDD:276809 6/22 (27%)
TPR repeat 330..358 CDD:276809
TPR repeat 363..391 CDD:276809
TPR repeat 396..426 CDD:276809
TPR repeat 431..459 CDD:276809
TPR repeat 465..493 CDD:276809
TPR repeat 498..537 CDD:276809
TPR repeat 542..567 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.