DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and STI1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_014670.1 Gene:STI1 SGDID:S000005553 Length:589 Species:Saccharomyces cerevisiae

Alignment Length:335 Identity:63/336 (19%)
Similarity:110/336 (33%) Gaps:124/336 (37%)


  Fly     2 PLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSS 66
            |.|:.:.::|.:.|                 |.:|.:..||..:|             |.:.:.|
Yeast   211 PETSKSTEQKKDAE-----------------PQSDSTTSKENSSK-------------APQKEES 245

  Fly    67 KKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQ-------FTFMRQ---------- 114
            |:.:...:..||.|....:..|.....::..:...|:.:.|:       .|::..          
Yeast   246 KESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGE 310

  Fly   115 ----IDSEPDDRVLAREQRED---VAETFRRMGNYEYRKLNFSLAK--DYYSKGIQYIKDSPVL- 169
                |.:..|.....||.|.|   ::::|.|:|| .|.||. .|.|  :||.|.:...:.:.:| 
Yeast   311 YETAISTLNDAVEQGREMRADYKVISKSFARIGN-AYHKLG-DLKKTIEYYQKSLTEHRTADILT 373

  Fly   170 -----------------------------------------------------------YVNRAL 175
                                                                       |.|||.
Yeast   374 KLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAA 438

  Fly   176 CFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARR-----FNRSD 235
            ...||..|...|.||:..:.| |.:::||::.:|.|...:.:..:...::|.||.     .|.|.
Yeast   439 ALAKLMSFPEAIADCNKAIEK-DPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSS 502

  Fly   236 ADFIDEFLDK 245
            |..||:...|
Yeast   503 AREIDQLYYK 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 23/124 (19%)
TPR repeat 133..161 CDD:276809 12/30 (40%)
TPR repeat 166..197 CDD:276809 12/91 (13%)
STI1NP_014670.1 TPR_11 <5..490 CDD:330823 55/312 (18%)
PLN03088 5..>106 CDD:330826
TPR repeat 5..33 CDD:276809
TPR repeat 39..69 CDD:276809
TPR repeat 74..102 CDD:276809
TPR repeat 262..290 CDD:276809 3/28 (11%)
TPR repeat 294..324 CDD:276809 3/30 (10%)
TPR repeat 336..363 CDD:276809 12/29 (41%)
PLN03088 396..>549 CDD:330826 25/119 (21%)
TPR repeat 396..424 CDD:276809 0/28 (0%)
TPR repeat 429..459 CDD:276809 10/30 (33%)
TPR repeat 464..490 CDD:276809 5/26 (19%)
STI1 537..576 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.