DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and STI1

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_014670.1 Gene:STI1 / 854192 SGDID:S000005553 Length:589 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:63/335 - (18%)
Similarity:110/335 - (32%) Gaps:124/335 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSS 66
            |.|:.:.::|.:.|                 |.:|.:..||..:|             |.:.:.|
Yeast   211 PETSKSTEQKKDAE-----------------PQSDSTTSKENSSK-------------APQKEES 245

  Fly    67 KKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQ-------FTFMRQ---------- 114
            |:.:...:..||.|....:..|.....::..:...|:.:.|:       .|::..          
Yeast   246 KESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGE 310

  Fly   115 ----IDSEPDDRVLAREQRED---VAETFRRMGNYEYRKLNFSLAK--DYYSKGIQYIKDSPVL- 169
                |.:..|.....||.|.|   ::::|.|:|| .|.||. .|.|  :||.|.:...:.:.:| 
Yeast   311 YETAISTLNDAVEQGREMRADYKVISKSFARIGN-AYHKLG-DLKKTIEYYQKSLTEHRTADILT 373

  Fly   170 -----------------------------------------------------------YVNRAL 175
                                                                       |.|||.
Yeast   374 KLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAA 438

  Fly   176 CFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARR-----FNRSD 235
            ...||..|...|.||:..:.| |.:::||::.:|.|...:.:..:...::|.||.     .|.|.
Yeast   439 ALAKLMSFPEAIADCNKAIEK-DPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSS 502

  Fly   236 ADFIDEFLDK 245
            |..||:...|
Yeast   503 AREIDQLYYK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 34/161 (21%)
TPR repeat 133..161 CDD:276809 12/29 (41%)
TPR repeat 166..197 CDD:276809 11/90 (12%)
STI1NP_014670.1 Spy 5..>110 CDD:443119
TPR repeat 5..33 CDD:276809
TPR repeat 39..69 CDD:276809
TPR repeat 74..102 CDD:276809
STI1 138..193 CDD:436075
TPR repeat 262..290 CDD:276809 3/27 (11%)
LapB 267..515 CDD:442196 48/249 (19%)
TPR repeat 294..324 CDD:276809 3/29 (10%)
TPR repeat 336..363 CDD:276809 12/28 (43%)
TPR repeat 396..424 CDD:276809 0/27 (0%)
TPR repeat 429..459 CDD:276809 10/29 (34%)
TPR repeat 464..490 CDD:276809 5/25 (20%)
STI1 527..581 CDD:436075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.