DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and SWA2

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_010606.1 Gene:SWA2 / 851918 SGDID:S000002728 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:59/300 - (19%)
Similarity:100/300 - (33%) Gaps:95/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TNTVDKKNEHEKPFGLEIPKPELF-----IYQHPAA---DESFLKEQPTKV-------------- 47
            :.|.||..:::.|...:.|...||     :...|.|   |:..|.:..||:              
Yeast   247 SKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSS 311

  Fly    48 ---------------EDVIE--YLDVLENANKTDSSKKRQK----------STITMDDIKCI-VT 84
                           |.:||  .||..| .|.|:|......          |||.:.||:.. ..
Yeast   312 SPTSGILIEENSRRNEPLIEDSLLDFSE-GNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYN 375

  Fly    85 RRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNF 149
            ...|..|:.|:.|.    .||:.| .:.:.:::.|.:..|......::..:..::|.|.....|.
Yeast   376 EFKAKGTSLFKNGD----YINSLQ-EYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENS 435

  Fly   150 SLAKDYY----SKGIQYIKDS----------PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEH 200
            |:|.:.:    :|....|.:|          |.:.:.||..|..|..||..:             
Yeast   436 SMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL------------- 487

  Fly   201 YLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFID 240
                     ..|:.|..:..|:   |:..:..|...|||:
Yeast   488 ---------ETYQELIKKNFFD---DKIMQGKRRCQDFIN 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 15/75 (20%)
TPR repeat 133..161 CDD:276809 6/31 (19%)
TPR repeat 166..197 CDD:276809 8/40 (20%)
SWA2NP_010606.1 Ubiq-assoc 138..181 CDD:401184
TPR <374..497 CDD:223533 26/149 (17%)
TPR repeat 374..402 CDD:276809 7/32 (22%)
TPR repeat 407..441 CDD:276809 6/33 (18%)
TPR repeat 467..495 CDD:276809 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.