DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and SWA2

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_010606.1 Gene:SWA2 SGDID:S000002728 Length:668 Species:Saccharomyces cerevisiae

Alignment Length:300 Identity:59/300 (20%)
Similarity:100/300 (33%) Gaps:95/300 (32%)


  Fly     5 TNTVDKKNEHEKPFGLEIPKPELF-----IYQHPAA---DESFLKEQPTKV-------------- 47
            :.|.||..:::.|...:.|...||     :...|.|   |:..|.:..||:              
Yeast   247 SKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSS 311

  Fly    48 ---------------EDVIE--YLDVLENANKTDSSKKRQK----------STITMDDIKCI-VT 84
                           |.:||  .||..| .|.|:|......          |||.:.||:.. ..
Yeast   312 SPTSGILIEENSRRNEPLIEDSLLDFSE-GNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYN 375

  Fly    85 RRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNF 149
            ...|..|:.|:.|.    .||:.| .:.:.:::.|.:..|......::..:..::|.|.....|.
Yeast   376 EFKAKGTSLFKNGD----YINSLQ-EYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENS 435

  Fly   150 SLAKDYY----SKGIQYIKDS----------PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEH 200
            |:|.:.:    :|....|.:|          |.:.:.||..|..|..||..:             
Yeast   436 SMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL------------- 487

  Fly   201 YLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFID 240
                     ..|:.|..:..|:   |:..:..|...|||:
Yeast   488 ---------ETYQELIKKNFFD---DKIMQGKRRCQDFIN 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 15/76 (20%)
TPR repeat 133..161 CDD:276809 6/32 (19%)
TPR repeat 166..197 CDD:276809 8/41 (20%)
SWA2NP_010606.1 CytochromB561_N 8..>102 CDD:286826
Ubiq-assoc 138..179 CDD:286256
TPR repeat 374..402 CDD:276809 7/33 (21%)
TPR_11 376..443 CDD:290150 14/72 (19%)
TPR repeat 407..441 CDD:276809 6/34 (18%)
TPR repeat 467..495 CDD:276809 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.