DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Sugt1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_080750.1 Gene:Sugt1 / 67955 MGIID:1915205 Length:336 Species:Mus musculus


Alignment Length:103 Identity:24/103 - (23%)
Similarity:42/103 - (40%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 AKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIID-----------CDYVLAK-----IDEH 200
            |.:..:|.::...|....|..||.|.|.|.:::.||.|           |..:|.|     .::.
Mouse    30 ALEELTKALEQNPDDAQYYCQRAYCHILLGKYRDGIADVKKSLELNPNNCTALLRKGICEYHEKD 94

  Fly   201 YLRAWLYRAAAYKRLNDEPNFEYSVDRARRF-NRSDAD 237
            |..|....|...|..:.:.||:..:.|.:.. |.|:::
Mouse    95 YASALETFAEGQKLDSTDTNFDTWIKRCQEIQNGSESE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 13/53 (25%)
TPR repeat 133..161 CDD:276809 2/8 (25%)
TPR repeat 166..197 CDD:276809 12/46 (26%)
Sugt1NP_080750.1 TPR 1 11..44 2/13 (15%)
PLN03088 21..336 CDD:215568 24/103 (23%)
Motor_domain <38..>107 CDD:277568 16/68 (24%)
TPR repeat 44..74 CDD:276809 9/29 (31%)
TPR 2 45..78 9/32 (28%)
TPR 45..78 CDD:197478 9/32 (28%)
TPR 3 79..112 7/32 (22%)
TPR repeat 79..107 CDD:276809 6/27 (22%)
p23_CS_hSgt1_like 146..229 CDD:107239
SGS 256..336 CDD:282811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.