DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34274 and Sugt1

DIOPT Version :9

Sequence 1:	NP_001097807.1	Gene:	CG34274 / 5740212	FlyBaseID:	FBgn0085303	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_080750.1	Gene:	Sugt1 / 67955	MGIID:	1915205	Length:	336	Species:	Mus musculus

Alignment Length:	103	Identity:	24/103 - (23%)
Similarity:	42/103 - (40%)	Gaps:	17/103 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   152 AKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIID-----------CDYVLAK-----IDEH 200
            |.:..:|.::...|....|..||.|.|.|.:::.||.|           |..:|.|     .::.
Mouse    30 ALEELTKALEQNPDDAQYYCQRAYCHILLGKYRDGIADVKKSLELNPNNCTALLRKGICEYHEKD 94

  Fly   201 YLRAWLYRAAAYKRLNDEPNFEYSVDRARRF-NRSDAD 237
            |..|....|...|..:.:.||:..:.|.:.. |.|:::
Mouse    95 YASALETFAEGQKLDSTDTNFDTWIKRCQEIQNGSESE 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34274	NP_001097807.1	TPR_11	133..195	CDD:290150	13/53 (25%)
		TPR repeat	133..161	CDD:276809	2/8 (25%)
		TPR repeat	166..197	CDD:276809	12/46 (26%)
Sugt1	NP_080750.1	TPR 1	11..44		2/13 (15%)
		PLN03088	21..336	CDD:215568	24/103 (23%)
		Motor_domain	<38..>107	CDD:277568	16/68 (24%)
		TPR repeat	44..74	CDD:276809	9/29 (31%)
		TPR 2	45..78		9/32 (28%)
		TPR	45..78	CDD:197478	9/32 (28%)
		TPR 3	79..112		7/32 (22%)
		TPR repeat	79..107	CDD:276809	6/27 (22%)
		p23_CS_hSgt1_like	146..229	CDD:107239
		SGS	256..336	CDD:282811
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900