DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and TTC31

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_011531337.1 Gene:TTC31 HGNCID:25759 Length:539 Species:Homo sapiens

Alignment Length:257 Identity:46/258 (18%)
Similarity:86/258 (33%) Gaps:93/258 (36%)


  Fly    20 LEIPKPE-LFIYQHPA---ADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIK 80
            |::..|: |.:.:..|   |:|...:|:..|           :.|.|....|||||.....:.::
Human   141 LQVAMPQKLLVTEEEANRLAEELVAEEERMK-----------QKAEKKRLKKKRQKERKRQERLE 194

  Fly    81 --CIVTRRSAVS------------TTTFRRGKAKRALINTNQFTFM---------------RQID 116
              |...:.|..|            ....:.|:.:.:|..::.|..:               :.::
Human   195 QYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLN 259

  Fly   117 SEPDDRVLA------------REQREDVAETFRR--MG--------------------------- 140
            .||..|.||            ||:|...:...:.  :|                           
Human   260 QEPQGRGLALQKMGQEEESPPREERPQQSPKVQEKDLGRLRPQDLLDFAPYPQASPGLLAAALQQ 324

  Fly   141 NYEYRKLNFSLAKD-YYSKGI----QYIKDSPV---LYVNRALCFIKLREFKLGIIDCDYVL 194
            :.|..||..|.|:: :|.:.:    |.:|.:|.   |:.||:.|..:|.:....:.|....|
Human   325 SQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAWALADAQVAL 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 17/100 (17%)
TPR repeat 133..161 CDD:276809 7/62 (11%)
TPR repeat 166..197 CDD:276809 8/33 (24%)
TTC31XP_011531337.1 TPR_11 324..390 CDD:290150 16/64 (25%)
TPR repeat 325..353 CDD:276809 7/28 (25%)
TPR repeat 358..388 CDD:276809 7/30 (23%)
TPR repeat 393..421 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.