DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and zgc:123010

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005169572.1 Gene:zgc:123010 ZFINID:ZDB-GENE-051120-15 Length:501 Species:Danio rerio

Alignment Length:263 Identity:46/264 (17%)
Similarity:102/264 (39%) Gaps:64/264 (24%)


  Fly     9 DKKNEHEKPFGLEIPKPELFIYQHPAADESFLKE-QPTKVED-VIEYLD------VLENANKTDS 65
            :::.|.|...|   |..||     ..::||.|:| ..:|||: .:..|:      .|.:.||   
Zfish    94 EEEEEEEDDAG---PDSEL-----DESEESELEEVVVSKVEEKPVALLNKSPSGPPLASGNK--- 147

  Fly    66 SKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQRE 130
            |.::|.:....:|....|......:..:..|.|||                    .:..::|.:|
Zfish   148 SNRQQGARSGEEDPGWDVNSAFVANAVSHIRPKAK--------------------SKGKSKENKE 192

  Fly   131 DVAETFRRMGNYEYR-KLNFSLAKDYYSKGIQYIKDSPV-------------------LYVNRAL 175
            :.:.....:|..|.: |.:.||.:    |||:::::...                   .:.||:.
Zfish   193 NESRPAEVIGFSEAKTKRSASLVE----KGIRFVQEGQYTQAVSLFTEAIKCDPKDYRFFGNRSY 253

  Fly   176 CFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFID 240
            |:..|.::.|.:.|.:..: ::...:.:.:..|.:|...|......|.::::..:.:....:.::
Zfish   254 CYCCLEQYALALADAEKSI-QMAPDWPKGYYRRGSALMGLKRYSEAEKAMEQVLKLDGDCEEAVN 317

  Fly   241 EFL 243
            :.|
Zfish   318 DLL 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 14/82 (17%)
TPR repeat 133..161 CDD:276809 8/29 (28%)
TPR repeat 166..197 CDD:276809 6/50 (12%)
zgc:123010XP_005169572.1 TPR_11 214..276 CDD:290150 10/67 (15%)
TPR repeat 214..239 CDD:276809 4/29 (14%)
TPR repeat 244..274 CDD:276809 6/31 (19%)
TPR_11 250..309 CDD:290150 10/60 (17%)
TPR_2 279..309 CDD:285020 4/30 (13%)
TPR repeat 279..307 CDD:276809 4/28 (14%)
TPR_11 282..343 CDD:290150 5/40 (13%)
TPR repeat 313..343 CDD:276809 1/9 (11%)
RRM <364..>438 CDD:223796
RRM 370..436 CDD:214636
zf-CCCH 471..492 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.