DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and zgc:123010

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005169572.1 Gene:zgc:123010 / 641500 ZFINID:ZDB-GENE-051120-15 Length:501 Species:Danio rerio


Alignment Length:267 Identity:47/267 - (17%)
Similarity:100/267 - (37%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DKKNEHEKPFGLEIPKPELFIYQHPAADESFLKE-QPTKVED-VIEYLD------VLENANKTDS 65
            :::.|.|...|   |..||     ..::||.|:| ..:|||: .:..|:      .|.:.||   
Zfish    94 EEEEEEEDDAG---PDSEL-----DESEESELEEVVVSKVEEKPVALLNKSPSGPPLASGNK--- 147

  Fly    66 SKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQRE 130
            |.::|.:....:|....|......:..:..|.|||                    .:..::|.:|
Zfish   148 SNRQQGARSGEEDPGWDVNSAFVANAVSHIRPKAK--------------------SKGKSKENKE 192

  Fly   131 DVAETFRRMGNYEYRKLNFSLAKDYYS-----KGIQYIKDSPV-------------------LYV 171
            :.:.....:|        ||.||...|     |||:::::...                   .:.
Zfish   193 NESRPAEVIG--------FSEAKTKRSASLVEKGIRFVQEGQYTQAVSLFTEAIKCDPKDYRFFG 249

  Fly   172 NRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDA 236
            ||:.|:..|.::.|.:.|.:..: ::...:.:.:..|.:|...|......|.::::..:.:....
Zfish   250 NRSYCYCCLEQYALALADAEKSI-QMAPDWPKGYYRRGSALMGLKRYSEAEKAMEQVLKLDGDCE 313

  Fly   237 DFIDEFL 243
            :.:::.|
Zfish   314 EAVNDLL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 15/85 (18%)
TPR repeat 133..161 CDD:276809 8/32 (25%)
TPR repeat 166..197 CDD:276809 6/49 (12%)
zgc:123010XP_005169572.1 TPR_11 214..276 CDD:290150 9/62 (15%)
TPR repeat 214..239 CDD:276809 3/24 (13%)
TPR repeat 244..274 CDD:276809 6/30 (20%)
TPR_11 250..309 CDD:290150 10/59 (17%)
TPR_2 279..309 CDD:285020 4/29 (14%)
TPR repeat 279..307 CDD:276809 4/27 (15%)
TPR_11 282..343 CDD:290150 5/39 (13%)
TPR repeat 313..343 CDD:276809 1/8 (13%)
RRM <364..>438 CDD:223796
RRM 370..436 CDD:214636
zf-CCCH 471..492 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.