DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and ttc12

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009289931.1 Gene:ttc12 ZFINID:ZDB-GENE-071016-4 Length:707 Species:Danio rerio

Alignment Length:200 Identity:46/200 (23%)
Similarity:95/200 (48%) Gaps:37/200 (19%)


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---RGK 98
            |.||:       ||.:..:::.:.|.:::|.:.          ..||.....:|:...:   :.|
Zfish    15 EKFLR-------DVDQINELVRDLNSSEASCQE----------NAIVKTEQLISSLEQKEQFKTK 62

  Fly    99 AKRALINT----------------NQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKL 147
            ..:.:|||                |...|::.::.:.:||...|:.:|:.|...|..||..:.:.
Zfish    63 INKTVINTSSSENNPLNIRYESSQNPENFLKILEKDAEDRCQRRKMKEERANVLREQGNEAFTQG 127

  Fly   148 NFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAY 212
            ::..|..:|::|::.::|...||.|||..||||:.:|..|.||::.| :.:|..::|:::...::
Zfish   128 DYETAVRFYTEGLEQLRDMQALYTNRAQAFIKLKRYKEAISDCEWAL-RCNEKCIKAFIHMGTSH 191

  Fly   213 KRLND 217
            ..|.|
Zfish   192 LALKD 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 22/62 (35%)
TPR repeat 133..161 CDD:276809 7/28 (25%)
TPR repeat 166..197 CDD:276809 14/31 (45%)
ttc12XP_009289931.1 TPR_11 112..178 CDD:290150 22/67 (33%)
TPR repeat 113..141 CDD:276809 7/28 (25%)
TPR repeat 146..176 CDD:276809 14/31 (45%)
TPR_11 149..212 CDD:290150 18/49 (37%)
TPR_1 150..180 CDD:278916 14/31 (45%)
TPR repeat 181..209 CDD:276809 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T595987
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.