DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and TTC12

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001305462.1 Gene:TTC12 / 54970 HGNCID:23700 Length:711 Species:Homo sapiens


Alignment Length:208 Identity:47/208 - (22%)
Similarity:96/208 - (46%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTI-----------TMDDIKCIVT-RRSAV 89
            :.|||       :|.|..::::..| :|....:||:.:           ..::.:|..| .::.:
Human    10 QKFLK-------NVDEISNLIQEMN-SDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMI 66

  Fly    90 STTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKD 154
            |...    .|.::....|...|:..::.:..:|...|.:.:.:|:..:..||..:.:.|:..|..
Human    67 SPPQ----TAMKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAIL 127

  Fly   155 YYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVL-----AKIDEHYLRAWLYRAAAYKR 214
            .||:|::.:||..|||.|||..::||.:::..::||::.|     .:.||...:|:.:...|...
Human   128 RYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWALKSFSFMQCDEKCTKAYFHMGKANLA 192

  Fly   215 LNDEPNFEYSVDR 227
            |.:     |||.|
Human   193 LKN-----YSVSR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 27/101 (27%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 11/35 (31%)
TTC12NP_001305462.1 TPR 105..>212 CDD:440225 30/101 (30%)
TPR 1 106..139 9/32 (28%)
TPR repeat 106..134 CDD:276809 8/27 (30%)
TPR repeat 139..175 CDD:276809 11/35 (31%)
TPR 3 180..213 7/26 (27%)
TPR repeat 180..208 CDD:276809 7/26 (27%)
TPR repeat 217..242 CDD:276809
armadillo repeat 561..597 CDD:293788
armadillo repeat 603..637 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.