DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and sugt1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001016156.1 Gene:sugt1 XenbaseID:XB-GENE-919559 Length:330 Species:Xenopus tropicalis

Alignment Length:129 Identity:32/130 (25%)
Similarity:54/130 (42%) Gaps:23/130 (18%)


  Fly    63 TDS--SKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTF--MRQIDSEPDDRV 123
            |||  ....|||   ::::...:..:|..:....:|..|...|.|.|....  .|.::.:|::  
 Frog    13 TDSYIGADPQKS---LEELTKAIEEKSDCAEYYCQRAYAHILLQNYNDAVLDAKRSLELQPNN-- 72

  Fly   124 LAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGI 187
                     |..|.|.|..|:...|:|.|::.:.|| |.:..|...:..    :|||.|.||.:
 Frog    73 ---------ASAFLRKGEAEFHLQNYSSAEESFKKG-QILDASTPTFPT----WIKLCEEKLNV 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 18/56 (32%)
TPR repeat 133..161 CDD:276809 10/28 (36%)
TPR repeat 166..197 CDD:276809 7/23 (30%)
sugt1NP_001016156.1 PLN03088 15..330 CDD:330826 30/128 (23%)
TPR repeat 38..68 CDD:276809 6/30 (20%)
TPR repeat 73..98 CDD:276809 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.