| Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007767.1 | Gene: | stip1 / 493606 | ZFINID: | ZDB-GENE-041121-17 | Length: | 542 | Species: | Danio rerio |
| Alignment Length: | 217 | Identity: | 51/217 - (23%) |
|---|---|---|---|
| Similarity: | 95/217 - (43%) | Gaps: | 43/217 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 ESFLKEQPTKVEDVIEYLDVLENA-----NKTDSSKKRQKSTITMD-------DIKCIVTRRSAV 89
Fly 90 STTTFRRGKAKRALINTNQFTFMRQIDSE--PD--------DRVLAREQR-----EDVAETFRRM 139
Fly 140 GNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRA 204
Fly 205 WLYRAAAYKRLNDEPNFEYSVD 226 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 21/61 (34%) |
| TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 166..197 | CDD:276809 | 12/30 (40%) | ||
| stip1 | NP_001007767.1 | TPR_11 | 7..69 | CDD:290150 | |
| TPR | 7..37 | CDD:197478 | |||
| TPR repeat | 7..32 | CDD:276809 | |||
| TPR repeat | 37..67 | CDD:276809 | |||
| TPR_11 | 40..103 | CDD:290150 | |||
| TPR repeat | 72..100 | CDD:276809 | |||
| TPR_11 | 224..285 | CDD:290150 | 10/43 (23%) | ||
| TPR repeat | 228..252 | CDD:276809 | 1/3 (33%) | ||
| TPR_1 | 230..257 | CDD:278916 | 3/8 (38%) | ||
| TPR_12 | 254..327 | CDD:290160 | 18/84 (21%) | ||
| TPR repeat | 257..287 | CDD:276809 | 6/36 (17%) | ||
| TPR | 299..327 | CDD:197478 | 7/32 (22%) | ||
| TPR repeat | 299..326 | CDD:276809 | 7/31 (23%) | ||
| TPR_11 | 359..423 | CDD:290150 | 21/64 (33%) | ||
| TPR repeat | 363..387 | CDD:276809 | 7/23 (30%) | ||
| TPR repeat | 392..422 | CDD:276809 | 12/30 (40%) | ||
| TPR_1 | 427..459 | CDD:278916 | 5/25 (20%) | ||
| TPR repeat | 427..455 | CDD:276809 | 5/25 (20%) | ||
| STI1 | 491..530 | CDD:128966 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||