DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and stip1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001007767.1 Gene:stip1 ZFINID:ZDB-GENE-041121-17 Length:542 Species:Danio rerio

Alignment Length:217 Identity:51/218 (23%)
Similarity:95/218 (44%) Gaps:43/218 (20%)


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENA-----NKTDSSKKRQKSTITMD-------DIKCIVTRRSAV 89
            |..:|..||.       :..|.|.     .|.|..|.|:.....:|       |.:.|....:.:
Zfish   248 EEAIKHDPTN-------MTYLSNQAAVYFEKGDFDKCRELCEKAIDVGRENREDYRQIAKAYARI 305

  Fly    90 STTTFRRGKAKRALINTNQFTFMRQIDSE--PD--------DRVLAREQR-----EDVAETFRRM 139
            ..:.|::.|.|.|:    || |.:.:...  ||        :::|..:::     .|:|...:..
Zfish   306 GNSYFKQEKYKEAV----QF-FNKSLTEHRTPDVLKKCQEAEKILKEQEKVAYINPDLALEEKNK 365

  Fly   140 GNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRA 204
            ||..::|.::.||..:||:.|:.......|:.|||.|:.||.||:|.:.||:..: .:|..:::.
Zfish   366 GNDAFQKGDYPLAMKHYSEAIKRNPYDAKLFSNRAACYTKLLEFQLALKDCEECI-NLDSTFIKG 429

  Fly   205 WLYRAAAYKRLNDEPNFEYSVD 226
            :..:.||.:.:.|   |..::|
Zfish   430 YTRKGAALEAMKD---FSKAMD 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 21/62 (34%)
TPR repeat 133..161 CDD:276809 9/28 (32%)
TPR repeat 166..197 CDD:276809 12/31 (39%)
stip1NP_001007767.1 TPR_11 7..69 CDD:290150
TPR 7..37 CDD:197478
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 224..285 CDD:290150 10/44 (23%)
TPR repeat 228..252 CDD:276809 1/4 (25%)
TPR_1 230..257 CDD:278916 4/9 (44%)
TPR_12 254..327 CDD:290160 18/85 (21%)
TPR repeat 257..287 CDD:276809 7/37 (19%)
TPR 299..327 CDD:197478 7/33 (21%)
TPR repeat 299..326 CDD:276809 7/32 (22%)
TPR_11 359..423 CDD:290150 21/65 (32%)
TPR repeat 363..387 CDD:276809 8/24 (33%)
TPR repeat 392..422 CDD:276809 12/31 (39%)
TPR_1 427..459 CDD:278916 5/26 (19%)
TPR repeat 427..455 CDD:276809 5/26 (19%)
STI1 491..530 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.