DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and sugt1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001007362.1 Gene:sugt1 ZFINID:ZDB-GENE-041114-56 Length:322 Species:Danio rerio

Alignment Length:159 Identity:31/160 (19%)
Similarity:52/160 (33%) Gaps:51/160 (32%)


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKR 101
            :||:.|.|.:         .||..|:....|        .|:.:.:..|..|             
Zfish     9 DSFIDEDPRR---------ALEELNEALGEK--------ADNAEWLCQRAYA------------- 43

  Fly   102 ALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDS 166
                   :..:::.....||...|::.:..:|..|.|:|..||...||..|....:.|...  ||
Zfish    44 -------YILLKEYTKAIDDAKKAQDLQPGLALPFLRIGIAEYHLHNFVAAHQALTAGRDL--DS 99

  Fly   167 PVLYVNRALCFIKLREFKLGIIDCDYVLA 195
            .|            .||:..:..|:..:|
Zfish   100 SV------------EEFQTWMQHCETEMA 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 16/62 (26%)
TPR repeat 133..161 CDD:276809 10/28 (36%)
TPR repeat 166..197 CDD:276809 6/31 (19%)
sugt1NP_001007362.1 PLN03088 10..322 CDD:215568 31/159 (19%)
TPR repeat 33..63 CDD:276809 5/50 (10%)
TPR_1 34..65 CDD:278916 5/51 (10%)
TPR repeat 68..91 CDD:276809 9/23 (39%)
p23_CS_hSgt1_like 135..218 CDD:107239
SGS 242..322 CDD:282811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.