DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and CG6980

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:222 Identity:72/222 - (32%)
Similarity:115/222 - (51%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PTKVEDVIEY------LD-VLENANKTDSSKKR----QKSTITMDDIKC------IVTRRSAVST 91
            |:..:|..|:      :| :|:|....|....:    .|..|..|::..      :...|:.::.
  Fly    23 PSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKINFDNLDVDKVRLKVKENRTVINR 87

  Fly    92 TTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYY 156
            .:......|: :.:.||.:||.|::.:.:||..||.:.|..||..|..||..:|...:..|..:|
  Fly    88 KSLEEDNEKQ-VKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHY 151

  Fly   157 SKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNF 221
            .|.|..:|||.:.|.|||||:|||:.:|..:.||.|||.|:.|..||||||:|.|||.|..:..|
  Fly   152 DKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKF 216

  Fly   222 EYSVDRARRFNRSDADFIDEFLDKMRS 248
            |.||.:||..|.....:||:::.::.:
  Fly   217 EESVVKAREHNPKQLAYIDKYIKQLEA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 45/96 (47%)
TPR repeat 133..161 CDD:276809 9/27 (33%)
TPR repeat 166..197 CDD:276809 16/30 (53%)
CG6980NP_651289.1 Spy 117..>233 CDD:443119 52/115 (45%)
TPR repeat 128..156 CDD:276809 9/27 (33%)
TPR repeat 161..192 CDD:276809 16/30 (53%)
TPR repeat 197..225 CDD:276809 16/27 (59%)

Return to query results.
Submit another query.