DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and CG6980

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:222 Identity:72/222 - (32%)
Similarity:115/222 - (51%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PTKVEDVIEY------LD-VLENANKTDSSKKR----QKSTITMDDIKC------IVTRRSAVST 91
            |:..:|..|:      :| :|:|....|....:    .|..|..|::..      :...|:.::.
  Fly    23 PSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKINFDNLDVDKVRLKVKENRTVINR 87

  Fly    92 TTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYY 156
            .:......|: :.:.||.:||.|::.:.:||..||.:.|..||..|..||..:|...:..|..:|
  Fly    88 KSLEEDNEKQ-VKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHY 151

  Fly   157 SKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNF 221
            .|.|..:|||.:.|.|||||:|||:.:|..:.||.|||.|:.|..||||||:|.|||.|..:..|
  Fly   152 DKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKF 216

  Fly   222 EYSVDRARRFNRSDADFIDEFLDKMRS 248
            |.||.:||..|.....:||:::.::.:
  Fly   217 EESVVKAREHNPKQLAYIDKYIKQLEA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 27/61 (44%)
TPR repeat 133..161 CDD:276809 9/27 (33%)
TPR repeat 166..197 CDD:276809 16/30 (53%)
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 27/62 (44%)
TPR repeat 128..156 CDD:276809 9/27 (33%)
TPR repeat 161..192 CDD:276809 16/30 (53%)
TPR_1 162..190 CDD:278916 14/27 (52%)
TPR repeat 197..225 CDD:276809 16/27 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449143
Domainoid 1 1.000 44 1.000 Domainoid score I4681
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.