DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and CG6980

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster

Alignment Length:222 Identity:72/223 (32%)
Similarity:115/223 (52%) Gaps:18/223 (8%)


  Fly    44 PTKVEDVIEY------LD-VLENANKTDSSKKR----QKSTITMDDIKC------IVTRRSAVST 91
            |:..:|..|:      :| :|:|....|....:    .|..|..|::..      :...|:.::.
  Fly    23 PSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKINFDNLDVDKVRLKVKENRTVINR 87

  Fly    92 TTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYY 156
            .:......|: :.:.||.:||.|::.:.:||..||.:.|..||..|..||..:|...:..|..:|
  Fly    88 KSLEEDNEKQ-VKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHY 151

  Fly   157 SKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNF 221
            .|.|..:|||.:.|.|||||:|||:.:|..:.||.|||.|:.|..||||||:|.|||.|..:..|
  Fly   152 DKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKF 216

  Fly   222 EYSVDRARRFNRSDADFIDEFLDKMRS 248
            |.||.:||..|.....:||:::.::.:
  Fly   217 EESVVKAREHNPKQLAYIDKYIKQLEA 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 28/62 (45%)
TPR repeat 133..161 CDD:276809 10/28 (36%)
TPR repeat 166..197 CDD:276809 17/31 (55%)
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 28/63 (44%)
TPR repeat 128..156 CDD:276809 10/28 (36%)
TPR repeat 161..192 CDD:276809 17/31 (55%)
TPR_1 162..190 CDD:278916 15/28 (54%)
TPR repeat 197..225 CDD:276809 17/28 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133360673
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46540
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.