DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and stip1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_989360.1 Gene:stip1 XenbaseID:XB-GENE-958361 Length:543 Species:Xenopus tropicalis

Alignment Length:230 Identity:48/231 (21%)
Similarity:100/231 (43%) Gaps:31/231 (13%)


  Fly    10 KKNEHEKPFGLEIPKPELFIYQHPAADESFLKE-------QPTKVEDVIEYLDVLENANKTDSSK 67
            |:.:.||..|.|..|.:.|        |:.||.       .||.:..:.....|.......:..:
 Frog   223 KQAQKEKELGNEAYKKKDF--------ETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCR 279

  Fly    68 KRQKSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDS-----EPDDR 122
            :..:..|.:     :|.:.|....:.:..:.|:..|.|.|:...|:.....:...     :..::
 Frog   280 ELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEK 344

  Fly   123 VLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLRE 182
            :|..::|     .|:|...:..||..::|.::..|..:|::.|:...:...||.|||.|:.||.|
 Frog   345 ILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLE 409

  Fly   183 FKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |:|.:.||:..: :::..:::.:..:|||.:.:.|
 Frog   410 FQLALKDCEECI-RLEPKFIKGYTRKAAALEAMKD 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 20/62 (32%)
TPR repeat 133..161 CDD:276809 7/28 (25%)
TPR repeat 166..197 CDD:276809 13/31 (42%)
stip1NP_989360.1 PLN03088 <2..532 CDD:330826 48/231 (21%)
TPR repeat 4..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR repeat 72..100 CDD:276809
TPR repeat 225..253 CDD:276809 9/36 (25%)
TPR repeat 258..288 CDD:276809 2/30 (7%)
TPR repeat 300..328 CDD:276809 5/28 (18%)
TPR repeat 364..388 CDD:276809 6/24 (25%)
TPR repeat 393..423 CDD:276809 13/31 (42%)
TPR repeat 428..456 CDD:276809 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.