Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477354.1 | Gene: | Stip1 / 33202 | FlyBaseID: | FBgn0024352 | Length: | 490 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 60/271 - (22%) |
---|---|---|---|
Similarity: | 114/271 - (42%) | Gaps: | 53/271 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 TVDKKNEH----EKPFGLEIPKPELFIYQHPAADESFLKEQPTKVE----DVIEYLDVLENANKT 63
Fly 64 DSSKKRQKSTITMDDIKCIVTRRS-----AVSTTTFRRGKAKRALINTNQF-------------- 109
Fly 110 ---TFMRQIDSEPDDRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDS 166
Fly 167 PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRF 231
Fly 232 NRSDADFIDEF 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 25/61 (41%) |
TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 166..197 | CDD:276809 | 15/30 (50%) | ||
Stip1 | NP_477354.1 | TPR_11 | 6..69 | CDD:290150 | |
TPR repeat | 7..32 | CDD:276809 | |||
TPR repeat | 37..67 | CDD:276809 | |||
TPR_11 | 40..103 | CDD:290150 | |||
TPR repeat | 72..100 | CDD:276809 | |||
TPR_11 | 175..237 | CDD:290150 | 14/73 (19%) | ||
TPR repeat | 175..203 | CDD:276809 | 8/35 (23%) | ||
TPR_1 | 181..208 | CDD:278916 | 7/34 (21%) | ||
TPR_12 | 205..278 | CDD:290160 | 14/76 (18%) | ||
TPR repeat | 208..238 | CDD:276809 | 5/33 (15%) | ||
TPR repeat | 250..278 | CDD:276809 | 6/27 (22%) | ||
TPR_1 | 250..>276 | CDD:278916 | 6/25 (24%) | ||
TPR_11 | 309..375 | CDD:290150 | 26/66 (39%) | ||
TPR repeat | 310..338 | CDD:276809 | 8/27 (30%) | ||
TPR_1 | <317..343 | CDD:278916 | 7/25 (28%) | ||
TPR repeat | 343..373 | CDD:276809 | 15/30 (50%) | ||
TPR_1 | 378..411 | CDD:278916 | 1/32 (3%) | ||
TPR repeat | 378..406 | CDD:276809 | 1/27 (4%) | ||
STI1 | 439..478 | CDD:128966 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |