DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Stip1

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:114/271 - (42%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVDKKNEH----EKPFGLEIPKPELFIYQHPAADESFLKEQPTKVE----DVIEYLDVLENANKT 63
            |.::||::    ||..|....|.:.|        |:.||.....:|    |:..|    .|....
  Fly   166 TEEQKNKYFARKEKELGNAAYKKKDF--------ETALKHYHAAIEHDPTDITFY----NNIAAV 218

  Fly    64 DSSKKRQKSTITMDDIKCIVTRRS-----AVSTTTFRRGKAKRALINTNQF-------------- 109
            ...:|..:..|...:....|.|.|     .::.:..|.|...|.|.|..|.              
  Fly   219 HFERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTP 283

  Fly   110 ---TFMRQIDSEPDDRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDS 166
               |.:.:::::     :..|:|     .:.||..:..||..::|.::|.|..:|::.|:...|.
  Fly   284 EIKTSLSEVEAK-----IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDD 343

  Fly   167 PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRF 231
            |.||.|||.|:.||..|.||:.|||..: |:||.:::.::.:....:.:..:...:.:..:|...
  Fly   344 PKLYSNRAACYTKLAAFDLGLKDCDTCI-KLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALEL 407

  Fly   232 NRSDADFIDEF 242
            :.::|:.|:.:
  Fly   408 DPNNAEAIEGY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 30/101 (30%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 15/30 (50%)
Stip1NP_477354.1 TPR repeat 7..32 CDD:276809
TPR 10..276 CDD:440225 26/121 (21%)
TPR repeat 37..67 CDD:276809
TPR repeat 72..100 CDD:276809
LapB 173..415 CDD:442196 56/259 (22%)
TPR repeat 175..203 CDD:276809 8/35 (23%)
TPR repeat 208..238 CDD:276809 5/33 (15%)
TPR repeat 250..278 CDD:276809 6/27 (22%)
TPR repeat 310..338 CDD:276809 8/27 (30%)
TPR repeat 343..373 CDD:276809 15/30 (50%)
TPR repeat 378..406 CDD:276809 1/27 (4%)
STI1 429..482 CDD:436075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.