DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Stip1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:114/271 - (42%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVDKKNEH----EKPFGLEIPKPELFIYQHPAADESFLKEQPTKVE----DVIEYLDVLENANKT 63
            |.::||::    ||..|....|.:.|        |:.||.....:|    |:..|    .|....
  Fly   166 TEEQKNKYFARKEKELGNAAYKKKDF--------ETALKHYHAAIEHDPTDITFY----NNIAAV 218

  Fly    64 DSSKKRQKSTITMDDIKCIVTRRS-----AVSTTTFRRGKAKRALINTNQF-------------- 109
            ...:|..:..|...:....|.|.|     .::.:..|.|...|.|.|..|.              
  Fly   219 HFERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTP 283

  Fly   110 ---TFMRQIDSEPDDRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDS 166
               |.:.:::::     :..|:|     .:.||..:..||..::|.::|.|..:|::.|:...|.
  Fly   284 EIKTSLSEVEAK-----IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDD 343

  Fly   167 PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRF 231
            |.||.|||.|:.||..|.||:.|||..: |:||.:::.::.:....:.:..:...:.:..:|...
  Fly   344 PKLYSNRAACYTKLAAFDLGLKDCDTCI-KLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALEL 407

  Fly   232 NRSDADFIDEF 242
            :.::|:.|:.:
  Fly   408 DPNNAEAIEGY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 25/61 (41%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 15/30 (50%)
Stip1NP_477354.1 TPR_11 6..69 CDD:290150
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 175..237 CDD:290150 14/73 (19%)
TPR repeat 175..203 CDD:276809 8/35 (23%)
TPR_1 181..208 CDD:278916 7/34 (21%)
TPR_12 205..278 CDD:290160 14/76 (18%)
TPR repeat 208..238 CDD:276809 5/33 (15%)
TPR repeat 250..278 CDD:276809 6/27 (22%)
TPR_1 250..>276 CDD:278916 6/25 (24%)
TPR_11 309..375 CDD:290150 26/66 (39%)
TPR repeat 310..338 CDD:276809 8/27 (30%)
TPR_1 <317..343 CDD:278916 7/25 (28%)
TPR repeat 343..373 CDD:276809 15/30 (50%)
TPR_1 378..411 CDD:278916 1/32 (3%)
TPR repeat 378..406 CDD:276809 1/27 (4%)
STI1 439..478 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.