DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and CG31294

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster


Alignment Length:228 Identity:106/228 - (46%)
Similarity:139/228 - (60%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---- 95
            |||||| .|.:.:.||::.|:.|:||||.|:..|.:      ::.|..|.....|:.|.|.    
  Fly     3 ADESFL-NQRSLLMDVMKQLEDLQNANKMDTGTKGK------EEKKPEVDPSEGVTITNFMVFAR 60

  Fly    96 --RGKAKRAL------INTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
              |.|:.|.|      .|.||.:||||||..|.||..||..||.||::|||:||.|||:.|:..|
  Fly    61 DVRKKSSRYLKRVQKMSNINQISFMRQIDVSPKDRAEARRDREIVADSFRRLGNEEYRRTNYEKA 125

  Fly   153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            ..:|||.|||:.||||||.||||..||.|:|||.:.|.|||:..:|..:||||||||.|..|||:
  Fly   126 VYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALARLNN 190

  Fly   218 EPNFEYSVDRARRFNRSDAD--FIDEFLDKMRS 248
            |..||.::..||..|||..|  :|:.||:|.::
  Fly   191 ESEFEIAIANARLLNRSQKDKKYIEYFLEKFKT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 55/96 (57%)
TPR repeat 133..161 CDD:276809 14/27 (52%)
TPR repeat 166..197 CDD:276809 19/30 (63%)
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 53/92 (58%)
TPR repeat 106..134 CDD:276809 14/27 (52%)
TPR repeat 139..170 CDD:276809 19/30 (63%)

Return to query results.
Submit another query.