DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and CG31294

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732055.1 Gene:CG31294 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster

Alignment Length:228 Identity:106/229 (46%)
Similarity:139/229 (61%) Gaps:21/229 (9%)


  Fly    35 ADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---- 95
            |||||| .|.:.:.||::.|:.|:||||.|:..|.:      ::.|..|.....|:.|.|.    
  Fly     3 ADESFL-NQRSLLMDVMKQLEDLQNANKMDTGTKGK------EEKKPEVDPSEGVTITNFMVFAR 60

  Fly    96 --RGKAKRAL------INTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
              |.|:.|.|      .|.||.:||||||..|.||..||..||.||::|||:||.|||:.|:..|
  Fly    61 DVRKKSSRYLKRVQKMSNINQISFMRQIDVSPKDRAEARRDREIVADSFRRLGNEEYRRTNYEKA 125

  Fly   153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            ..:|||.|||:.||||||.||||..||.|:|||.:.|.|||:..:|..:||||||||.|..|||:
  Fly   126 VYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALARLNN 190

  Fly   218 EPNFEYSVDRARRFNRSDAD--FIDEFLDKMRS 248
            |..||.::..||..|||..|  :|:.||:|.::
  Fly   191 ESEFEIAIANARLLNRSQKDKKYIEYFLEKFKT 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 37/62 (60%)
TPR repeat 133..161 CDD:276809 15/28 (54%)
TPR repeat 166..197 CDD:276809 19/31 (61%)
CG31294NP_732055.1 TPR_11 106..172 CDD:290150 38/66 (58%)
TPR repeat 106..134 CDD:276809 15/28 (54%)
TPR repeat 139..170 CDD:276809 19/31 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133360565
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46540
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.