DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and ucp7

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_593480.1 Gene:ucp7 / 2542191 PomBaseID:SPAC17A5.12 Length:697 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:46/241 - (19%)
Similarity:99/241 - (41%) Gaps:64/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAA-DESFLKEQPTKVEDVIEYLDVLENANKTDSS 66
            |....:.|:..|:.|...::.:..:...|..:. |||.|          :::|     .:|:|:|
pombe   309 LPKTPIPKRKPHKVPMNEKVSEDRITTNQSRSGNDESSL----------VDFL-----TSKSDNS 358

  Fly    67 KKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQRED 131
            .....|. |.:..:.|:  .:|..:||.|:       :|.|          :|....:.:.:.|.
pombe   359 SFNFPSD-TYEGTENIL--ETAYESTTARQ-------VNNN----------KPGKSTVKKREEET 403

  Fly   132 -------VAETFRRMGNYEYRKLNFSLAKDYYSKGI-----QYIKDSPVLYVNRALCFIKLREFK 184
                   :.|..:..||..:||.:||.|.:.::..:     ::.|..|:| .||:||:.|:.:.|
pombe   404 LNNMVSALVEEQQSTGNELFRKGDFSQAIEEFTNSLSQLPAKHTKRVPLL-SNRSLCYQKVGDLK 467

  Fly   185 LGIIDCDYVL---------------AKIDEHYLRAWLYRAAAYKRL 215
            ..:.|.|.::               ..::::|::..:.:|...::|
pombe   468 TCLQDVDELVDIIGEEKGHGESIRDKSMNDYYVKNMVRKAQVLEQL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 19/81 (23%)
TPR repeat 133..161 CDD:276809 8/32 (25%)
TPR repeat 166..197 CDD:276809 10/45 (22%)
ucp7NP_593480.1 UBA 183..218 CDD:279021
TPR_11 419..479 CDD:290150 18/60 (30%)
TPR repeat 449..479 CDD:276809 10/30 (33%)
TPR repeat 500..528 CDD:276809 2/14 (14%)
PKc_like <568..638 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.