DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Ttc12

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_766358.1 Gene:Ttc12 / 235330 MGIID:2444588 Length:704 Species:Mus musculus


Alignment Length:178 Identity:42/178 - (23%)
Similarity:88/178 - (49%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTR-------RSAVSTTTFRRGKAKRALI 104
            :|:|.|...:::..| :|....:||:.:..:....::.|       |:.::.|.....:......
Mouse    13 LENVDEITSLIQEMN-SDDPFIQQKAVLDSEKKLLLMEREQEEDGCRTTLNKTMISPPQTPENAD 76

  Fly   105 NTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVL 169
            ..:...|:..::.:..:|...|.:...:|:..:..||..:.:.::..|..:||:|:..:||..||
Mouse    77 EMSPDAFLASVEKDAKERAKRRRENRVLADALKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVL 141

  Fly   170 YVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |.|||..||||.:::..::|||:.| |.||:..:|:.:...|:..|.:
Mouse   142 YTNRAQAFIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGKAHVALKN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 22/61 (36%)
TPR repeat 133..161 CDD:276809 7/27 (26%)
TPR repeat 166..197 CDD:276809 14/30 (47%)
Ttc12NP_766358.1 TPR_11 105..170 CDD:290150 24/65 (37%)
TPR 1 105..138 8/32 (25%)
TPR repeat 105..133 CDD:276809 7/27 (26%)
TPR repeat 138..168 CDD:276809 14/30 (47%)
TPR 2 139..172 17/33 (52%)
TPR_11 141..204 CDD:290150 19/49 (39%)
TPR_1 142..172 CDD:278916 15/30 (50%)
TPR 3 173..206 3/16 (19%)
TPR repeat 173..198 CDD:276809 3/16 (19%)
TPR_1 174..205 CDD:278916 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11152
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm42394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.