DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and Ttc12

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_766358.1 Gene:Ttc12 MGIID:2444588 Length:704 Species:Mus musculus

Alignment Length:178 Identity:42/179 (23%)
Similarity:88/179 (49%) Gaps:9/179 (5%)


  Fly    47 VEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTR-------RSAVSTTTFRRGKAKRALI 104
            :|:|.|...:::..| :|....:||:.:..:....::.|       |:.::.|.....:......
Mouse    13 LENVDEITSLIQEMN-SDDPFIQQKAVLDSEKKLLLMEREQEEDGCRTTLNKTMISPPQTPENAD 76

  Fly   105 NTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVL 169
            ..:...|:..::.:..:|...|.:...:|:..:..||..:.:.::..|..:||:|:..:||..||
Mouse    77 EMSPDAFLASVEKDAKERAKRRRENRVLADALKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVL 141

  Fly   170 YVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |.|||..||||.:::..::|||:.| |.||:..:|:.:...|:..|.:
Mouse   142 YTNRAQAFIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGKAHVALKN 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 23/62 (37%)
TPR repeat 133..161 CDD:276809 7/28 (25%)
TPR repeat 166..197 CDD:276809 15/31 (48%)
Ttc12NP_766358.1 TPR_11 105..170 CDD:290150 25/66 (38%)
TPR 1 105..138 9/33 (27%)
TPR repeat 105..133 CDD:276809 7/28 (25%)
TPR repeat 138..168 CDD:276809 15/31 (48%)
TPR 2 139..172 17/34 (50%)
TPR_11 141..204 CDD:290150 19/50 (38%)
TPR_1 142..172 CDD:278916 15/31 (48%)
TPR 3 173..206 3/17 (18%)
TPR repeat 173..198 CDD:276809 3/17 (18%)
TPR_1 174..205 CDD:278916 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T615305
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.