DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Stip1

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_058017.1 Gene:Stip1 / 20867 MGIID:109130 Length:543 Species:Mus musculus


Alignment Length:241 Identity:52/241 - (21%)
Similarity:100/241 - (41%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKPELFIYQHPAADESFLKEQ--------------------------PTKVEDVIEYLDVLENAN 61
            ||||......|...:..|||:                          ||.:..:.....|  :..
Mouse   209 PKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAV--HFE 271

  Fly    62 KTDSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEP 119
            |.|.:|.|:  :..|.:     :|.:.|....:.:..:.|:..|.|.|:...|:.....:   .|
Mouse   272 KGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHR---TP 333

  Fly   120 D--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYV 171
            |        :::|..::|     .|:|...:..||..::|.::..|..:|::.|:.......||.
Mouse   334 DVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYS 398

  Fly   172 NRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |||.|:.||.||:|.:.||:..: :::..:::.:..:|||.:.:.|
Mouse   399 NRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKD 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 28/109 (26%)
TPR repeat 133..161 CDD:276809 6/27 (22%)
TPR repeat 166..197 CDD:276809 13/30 (43%)
Stip1NP_058017.1 TPR 1 4..37
3a0801s09 <7..532 CDD:273380 52/241 (22%)
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233 8/23 (35%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 222..239 3/16 (19%)
TPR 4 225..258 4/32 (13%)
TPR repeat 229..253 CDD:276809 0/23 (0%)
TPR repeat 258..288 CDD:276809 6/31 (19%)
TPR 5 260..292 6/33 (18%)
TPR 6 300..333 5/35 (14%)
TPR repeat 300..328 CDD:276809 5/27 (19%)
TPR 7 360..393 7/32 (22%)
TPR repeat 364..388 CDD:276809 5/23 (22%)
TPR repeat 393..423 CDD:276809 13/30 (43%)
TPR 8 395..427 13/32 (41%)
TPR 9 428..461 4/16 (25%)
TPR repeat 428..456 CDD:276809 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.