DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Stip1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_058017.1 Gene:Stip1 / 20867 MGIID:109130 Length:543 Species:Mus musculus


Alignment Length:241 Identity:52/241 - (21%)
Similarity:100/241 - (41%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKPELFIYQHPAADESFLKEQ--------------------------PTKVEDVIEYLDVLENAN 61
            ||||......|...:..|||:                          ||.:..:.....|  :..
Mouse   209 PKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAV--HFE 271

  Fly    62 KTDSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEP 119
            |.|.:|.|:  :..|.:     :|.:.|....:.:..:.|:..|.|.|:...|:.....:   .|
Mouse   272 KGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHR---TP 333

  Fly   120 D--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYV 171
            |        :::|..::|     .|:|...:..||..::|.::..|..:|::.|:.......||.
Mouse   334 DVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYS 398

  Fly   172 NRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |||.|:.||.||:|.:.||:..: :::..:::.:..:|||.:.:.|
Mouse   399 NRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKD 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 28/109 (26%)
TPR repeat 133..161 CDD:276809 6/27 (22%)
TPR repeat 166..197 CDD:276809 13/30 (43%)
Stip1NP_058017.1 TPR 1 4..37
3a0801s09 <7..532 CDD:273380 52/241 (22%)
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233 8/23 (35%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 222..239 3/16 (19%)
TPR 4 225..258 4/32 (13%)
TPR repeat 229..253 CDD:276809 0/23 (0%)
TPR repeat 258..288 CDD:276809 6/31 (19%)
TPR 5 260..292 6/33 (18%)
TPR 6 300..333 5/35 (14%)
TPR repeat 300..328 CDD:276809 5/27 (19%)
TPR 7 360..393 7/32 (22%)
TPR repeat 364..388 CDD:276809 5/23 (22%)
TPR repeat 393..423 CDD:276809 13/30 (43%)
TPR 8 395..427 13/32 (41%)
TPR 9 428..461 4/16 (25%)
TPR repeat 428..456 CDD:276809 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.