DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and Stip1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_620266.1 Gene:Stip1 RGDID:621599 Length:543 Species:Rattus norvegicus

Alignment Length:241 Identity:52/242 (21%)
Similarity:107/242 (44%) Gaps:35/242 (14%)


  Fly     2 PLTTNTVDKKNE--HEKPFGLEIPKPELF---IYQHPAADESFLKEQPTKVEDVIEYLDVLENAN 61
            |:..:..:.|.:  .||..|.:..|.:.|   :..:..|.|.    .||.:..:.....|  :..
  Rat   213 PMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDKAKEL----DPTNMTYITNQAAV--HFE 271

  Fly    62 KTDSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEP 119
            |.|.:|.|:  :..|.:     :|.:.|....:.:..:.|:..:.|.|:...|:.....:   .|
  Rat   272 KGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEERYKDAIHFYNKSLAEHR---TP 333

  Fly   120 D--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYV 171
            |        :::|..::|     .|:|...:..||..::|.::..|..:|::.|:.......||.
  Rat   334 DVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYS 398

  Fly   172 NRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            |||.|:.||.||:|.:.||:..: :::..:::.:..:|||.:.:.|
  Rat   399 NRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKD 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 20/62 (32%)
TPR repeat 133..161 CDD:276809 7/28 (25%)
TPR repeat 166..197 CDD:276809 13/31 (42%)
Stip1NP_620266.1 TPR 1 4..37
TPR_11 6..69 CDD:290150
TPR 7..37 CDD:197478
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR_11 40..100 CDD:290150
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Bipartite nuclear localization signal. {ECO:0000255} 222..239 5/17 (29%)
TPR_11 224..287 CDD:290150 15/69 (22%)
TPR 4 225..258 9/37 (24%)
TPR repeat 229..253 CDD:276809 5/24 (21%)
TPR_1 231..258 CDD:278916 7/31 (23%)
TPR_12 255..328 CDD:290160 14/75 (19%)
TPR repeat 258..288 CDD:276809 6/32 (19%)
TPR 5 260..292 6/34 (18%)
TPR 6 300..333 4/36 (11%)
TPR 300..328 CDD:197478 4/28 (14%)
TPR repeat 300..328 CDD:276809 4/28 (14%)
TPR_11 360..425 CDD:290150 20/66 (30%)
TPR 7 360..393 7/33 (21%)
TPR_1 364..393 CDD:278916 6/29 (21%)
TPR repeat 364..388 CDD:276809 6/24 (25%)
TPR_11 393..458 CDD:290150 17/53 (32%)
TPR repeat 393..423 CDD:276809 13/31 (42%)
TPR_1 394..427 CDD:278916 13/34 (38%)
TPR 8 395..427 13/33 (39%)
TPR 9 428..461 4/17 (24%)
TPR repeat 428..456 CDD:276809 4/17 (24%)
STI1 492..531 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.