DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and sti-1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001367444.1 Gene:sti-1 / 178587 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans


Alignment Length:291 Identity:62/291 - (21%)
Similarity:115/291 - (39%) Gaps:83/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTVDKKNEHEKPF-----GLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDS 65
            |...|:.:.||..     .:|:....:..|.:.||  .:.:|:  |..:.:::.:          
 Worm    13 NAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAA--VYFEEK--KFAECVQFCE---------- 63

  Fly    66 SKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQID------------SE 118
             |..:....|..|.|.|....|       |.|.|           |.:|.|            ||
 Worm    64 -KAVEVGRETRADYKLIAKAMS-------RAGNA-----------FQKQNDLSLAVQWFHRSLSE 109

  Fly   119 PDDRVLAREQRE----------------DVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSP 167
            ..|..|.::.:|                ::|:..:..||..::|.::..|..:|::.::...::.
 Worm   110 FRDPELVKKVKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENA 174

  Fly   168 VLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAA-------------AYK-RLNDE 218
            :||.|||.|..||.||:..:.|||..: ::|..:::.::.:||             ||: .|..:
 Worm   175 ILYSNRAACLTKLMEFQRALDDCDTCI-RLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVD 238

  Fly   219 PNFEYSVDRARRFNRSDADFIDEFLDKMRSL 249
            |:.|.:.:..|...||:.:  |....|.|||
 Worm   239 PSNEEAREGVRNCLRSNDE--DPEKAKERSL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 19/61 (31%)
TPR repeat 133..161 CDD:276809 6/27 (22%)
TPR repeat 166..197 CDD:276809 13/30 (43%)
sti-1NP_001367444.1 3a0801s09 <5..>241 CDD:273380 53/261 (20%)
TPR repeat 5..33 CDD:276809 4/19 (21%)
TPR repeat 38..68 CDD:276809 6/44 (14%)
TPR repeat 80..108 CDD:276809 7/45 (16%)
TPR repeat 140..168 CDD:276809 6/27 (22%)
TPR repeat 173..203 CDD:276809 13/30 (43%)
TPR repeat 208..236 CDD:276809 4/27 (15%)
STI1 259..311 CDD:407696 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.