DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and sti-1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_503322.1 Gene:sti-1 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans

Alignment Length:291 Identity:62/292 (21%)
Similarity:115/292 (39%) Gaps:83/292 (28%)


  Fly     6 NTVDKKNEHEKPF-----GLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDS 65
            |...|:.:.||..     .:|:....:..|.:.||  .:.:|:  |..:.:::.:          
 Worm    13 NAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAA--VYFEEK--KFAECVQFCE---------- 63

  Fly    66 SKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQID------------SE 118
             |..:....|..|.|.|....|       |.|.|           |.:|.|            ||
 Worm    64 -KAVEVGRETRADYKLIAKAMS-------RAGNA-----------FQKQNDLSLAVQWFHRSLSE 109

  Fly   119 PDDRVLAREQRE----------------DVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSP 167
            ..|..|.::.:|                ::|:..:..||..::|.::..|..:|::.::...::.
 Worm   110 FRDPELVKKVKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENA 174

  Fly   168 VLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAA-------------AYK-RLNDE 218
            :||.|||.|..||.||:..:.|||..: ::|..:::.::.:||             ||: .|..:
 Worm   175 ILYSNRAACLTKLMEFQRALDDCDTCI-RLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVD 238

  Fly   219 PNFEYSVDRARRFNRSDADFIDEFLDKMRSL 249
            |:.|.:.:..|...||:.:  |....|.|||
 Worm   239 PSNEEAREGVRNCLRSNDE--DPEKAKERSL 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 19/62 (31%)
TPR repeat 133..161 CDD:276809 6/28 (21%)
TPR repeat 166..197 CDD:276809 13/31 (42%)
sti-1NP_503322.1 TPR_11 5..67 CDD:290150 11/69 (16%)
TPR_1 5..38 CDD:278916 5/25 (20%)
TPR repeat 5..33 CDD:276809 4/20 (20%)
BamD 7..172 CDD:276939 33/192 (17%)
TPR repeat 7..34 CDD:276939 5/21 (24%)
TPR_12 35..108 CDD:290160 17/106 (16%)
TPR repeat 38..68 CDD:276809 6/45 (13%)
TPR repeat 44..119 CDD:276939 20/108 (19%)
TPR repeat 80..108 CDD:276809 7/46 (15%)
TPR repeat 132..171 CDD:276939 6/39 (15%)
TPR_11 140..204 CDD:290150 19/65 (29%)
TPR repeat 140..168 CDD:276809 6/28 (21%)
TPR repeat 173..203 CDD:276809 13/31 (42%)
TPR repeat 208..236 CDD:276809 5/28 (18%)
STI1 269..308 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.