DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and STIP1

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001269581.1 Gene:STIP1 HGNCID:11387 Length:590 Species:Homo sapiens

Alignment Length:247 Identity:53/248 (21%)
Similarity:106/248 (43%) Gaps:48/248 (19%)


  Fly    10 KKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVED---VIEYLD---VLENANKT----- 63
            ||....:|...::|:     .:..|..|..|.....|.:|   .:::.|   .|:..|.|     
Human   253 KKETKPEPMEEDLPE-----NKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQ 312

  Fly    64 --------DSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMR 113
                    |.:|.|:  :..|.:     :|.:.|....:.:..:.|:..|.|.|:...|:.....
Human   313 AAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEH 377

  Fly   114 QIDSEPD--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKD 165
            :   .||        :::|..::|     .|:|...:..||..::|.::..|..:|::.|:....
Human   378 R---TPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPK 439

  Fly   166 SPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            ...||.|||.|:.||.||:|.:.||:..: :::..:::.:..:|||.:.:.|
Human   440 DAKLYSNRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKD 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 20/62 (32%)
TPR repeat 133..161 CDD:276809 7/28 (25%)
TPR repeat 166..197 CDD:276809 13/31 (42%)
STIP1NP_001269581.1 PLN03088 <54..579 CDD:330826 53/248 (21%)
TPR repeat 54..79 CDD:276809
TPR repeat 84..114 CDD:276809
TPR repeat 119..147 CDD:276809
TPR repeat 276..300 CDD:276809 4/24 (17%)
TPR repeat 305..335 CDD:276809 6/30 (20%)
TPR repeat 347..375 CDD:276809 5/28 (18%)
TPR repeat 411..435 CDD:276809 6/24 (25%)
TPR repeat 440..470 CDD:276809 13/31 (42%)
TPR repeat 475..503 CDD:276809 4/17 (24%)
TPR repeat 509..538 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.