DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34274 and ttc12

Sequence 1:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_017951452.1 Gene:ttc12 XenbaseID:XB-GENE-955705 Length:724 Species:Xenopus tropicalis

Alignment Length:249 Identity:63/250 (25%)
Similarity:111/250 (44%) Gaps:55/250 (22%)


  Fly    33 PAAD--ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRR---SAVSTT 92
            |..|  |||||       ::.|..|::::.|.:|.| .||::.:..|....::..:   ..:.||
 Frog     2 PTKDNLESFLK-------NIDEITDIIQDLNSSDES-HRQEAFLKADKRLALLKNKDNDDGIRTT 58

  Fly    93 TFRRGKAKRALINTN--------------------QFTFMRQIDSEPDDRVLAREQREDVAETFR 137
                  |.|.:|||:                    |...:..::.:..:|...|::...:|...:
 Frog    59 ------ANRTVINTSPEGMCASGSTYHANKDSRLMQENVLEHLEKDAKERAERRKENTAMANALK 117

  Fly   138 RMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYL 202
            .:||..:.|.::..|...||:|::.::|..|||.|||..||||.:::..|.||.:.| |.:|...
 Frog   118 ELGNKAFSKGDYETAVKCYSEGVEKLRDMQVLYTNRAQAFIKLEKYENAISDCQWAL-KCNEKCA 181

  Fly   203 RAWLYRAAAY--------------KRLNDEPNFEYSV-DRARRFNRSDADFIDE 241
            :|:::...||              |.|:.:||.|..| |.....:..:|:|..|
 Frog   182 KAYVHMGKAYLGLKEYSEARKCYLKLLDVDPNLEKLVKDYINTVDLQEANFKQE 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 23/62 (37%)
TPR repeat 133..161 CDD:276809 8/28 (29%)
TPR repeat 166..197 CDD:276809 15/31 (48%)
ttc12XP_017951452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.