DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: clos and tspeara

Sequence 1:NP_001097246.3 Gene:clos FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:XP_698991.2 Gene:tspeara ZFINID:ZDB-GENE-120215-12 Length:676 Species:Danio rerio

Alignment Length:361 Identity:85/362 (23%)
Similarity:138/362 (38%) Gaps:116/362 (32%)


  Fly    75 LDICILQLPTV-KYATALH---KNAAGVRHFAVYTWRPAEQDYQLLVELETPKAVALDCLAFAGR 135
            |||.:.|:|:| .:|...|   |..:|     :|.|  :...:||...:.|.||.|........:
Zfish   334 LDIELFQIPSVGLFAAMAHRATKPGSG-----IYRW--SHGHFQLYQNISTFKAQAWKQFTIGKK 391

  Fly   136 GYVAVSYNLTEPVSQAREGSPIYEISPETGIRTVQYFSGTHLRGMYLRISSQELTLLHAFESNAQ 200
            .::||| |...|.    :|.|                               ||:::        
Zfish   392 MFLAVS-NSMGPA----DGEP-------------------------------ELSVV-------- 412

  Fly   201 CPYFKWMGK--SFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQR 263
               ::|..|  .|.....:....||..|||.|:...::||||:....|.....|.:::|:..::.
Zfish   413 ---YRWSNKRLKFVPYQTLETHSARDWEAFQINNEAFLAVANHRTENGNHNIESVVYKWNPGTKT 474

  Fly   264 FQLFQRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQRL 328
            |::.|.:.::||.|.::|:     |...|||.:.|...||..:   .|:.||::..|.|..:|.:
Zfish   475 FEVNQTILTSGAYDWEFFT-----VGPYHFLAVANAFDGTSTQ---TDSSIYIWLGGAFQVFQTI 531

  Fly   329 -SFYALE--------RV-LPVQ--HSISEKFLLLVACNK---------------QDVKIYNLNDW 366
             :|.|.:        || |.|.  |.:.||...|...|.               ||:..|:..||
Zfish   532 RTFGATDWEMFQIGNRVFLAVANGHMLCEKGPSLYTINSTIYELDMTTKMFLKFQDIVTYSAVDW 596

  Fly   367 RFEESKVQFTEGALSRGVARMRSYEEGDQSYLVIAN 402
            .|                     :..||:.:||:||
Zfish   597 EF---------------------FTVGDEHFLVVAN 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 15/52 (29%)
tspearaXP_698991.2 LamG 68..228 CDD:304605
EPTP 369..416 CDD:281697 16/94 (17%)
EPTP 421..469 CDD:281697 14/48 (29%)
EPTP 475..520 CDD:281697 16/53 (30%)
EPTP 525..576 CDD:281697 13/51 (25%)
EPTP 581..627 CDD:281697 12/53 (23%)
EPTP 632..672 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304491975
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005836
OrthoInspector 1 1.000 T595996
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15261
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4919
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.