DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: clos and TSPEAR

Sequence 1:NP_001097246.3 Gene:clos FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:NP_659428.2 Gene:TSPEAR HGNCID:1268 Length:669 Species:Homo sapiens

Alignment Length:425 Identity:94/426 (22%)
Similarity:147/426 (35%) Gaps:155/426 (36%)


  Fly    45 RATAVPQ----FFDQASFSFD----------GLERVASVPVSFPLD----------------ICI 79
            |.|..||    ..:.|.|.||          |.|.|:.:.....||                |.:
Human   268 RVTLGPQPPCTEVEDAQFWFDASRKGLYLCVGNEWVSVLAAKERLDYVEEHQNLSTNSETLGIEV 332

  Fly    80 LQLPTVK--YATALHKNAAGVRHFAVYTWRPAEQDYQLLVELETPKAVALDCLAFAGRGYVAVSY 142
            .::|.|.  .|||..|..:     |||.|  .|:.:.....:.|.:|.|........:.::||: 
Human   333 FRIPQVGLFVATANRKATS-----AVYKW--TEEKFVSYQNIPTHQAQAWRHFTIGKKIFLAVA- 389

  Fly   143 NLTEPVSQAREGSPIYEISPETGIRTVQYFSGTHLRGMYLRISSQELTLLHAFESNAQCPYFKWM 207
            |. ||..:.:|.|.||                                              ||.
Human   390 NF-EPDEKGQEFSVIY----------------------------------------------KWS 407

  Fly   208 GK--SFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQRFQLFQRL 270
            .:  .|....:|....||..|||.:|...::||||:.:.:... ..|.|::|:..::.|:..|.:
Human   408 HRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHN-IDSVIYKWNPATRLFEANQTI 471

  Fly   271 RSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQRL-SFYALE 334
            .::||.|.::||     |....||::.||..||..:|   .:.:|:...|.|..:|.. :|.|.:
Human   472 ATSGAYDWEFFS-----VGPYSFLVVANTFNGTSTKV---HSHLYIRLLGSFQLFQSFPTFGAAD 528

  Fly   335 RVLPVQHSISEKFLLLVA-CNKQDVK-------------IYNLN------------------DWR 367
            ..:   ..|.|:..|.|| .:..||:             ||.||                  ||.
Human   529 WEV---FQIGERIFLAVANSHSYDVEMQVQNDSYVINSVIYELNVTAQAFVKFQDILTCSALDWE 590

  Fly   368 FEESKVQFTEGALSRGVARMRSYEEGDQSYLVIAN 402
            |                     :..|:..:||:||
Human   591 F---------------------FSVGEDYFLVVAN 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 15/52 (29%)
TSPEARNP_659428.2 LamG <82..222 CDD:304605
EAR 1. {ECO:0000255|PROSITE-ProRule:PRU00075} 313..358 12/52 (23%)
EAR 2. {ECO:0000255|PROSITE-ProRule:PRU00075} 360..408 14/96 (15%)
EPTP 360..407 CDD:281697 14/95 (15%)
EAR 3. {ECO:0000255|PROSITE-ProRule:PRU00075} 412..460 15/49 (31%)
EPTP 412..459 CDD:281697 15/48 (31%)
EAR 4. {ECO:0000255|PROSITE-ProRule:PRU00075} 464..506 15/50 (30%)
EPTP 465..501 CDD:281697 14/41 (34%)
EAR 5. {ECO:0000255|PROSITE-ProRule:PRU00075} 514..570 15/59 (25%)
EPTP 514..569 CDD:281697 14/58 (24%)
EAR 6. {ECO:0000255|PROSITE-ProRule:PRU00075} 574..622 8/53 (15%)
EPTP 575..620 CDD:281697 8/52 (15%)
EAR 7. {ECO:0000255|PROSITE-ProRule:PRU00075} 625..668
EPTP 625..665 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304492077
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005836
OrthoInspector 1 1.000 T1072294
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15261
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4919
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.