DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: clos and Tspear

Sequence 1:NP_001097246.3 Gene:clos FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:XP_017443498.1 Gene:Tspear RGDID:1563108 Length:663 Species:Rattus norvegicus

Alignment Length:429 Identity:95/430 (22%)
Similarity:162/430 (38%) Gaps:143/430 (33%)


  Fly    75 LDICILQLPTV-KYATALHKNAAGVRHFAVYTWRPAE-QDYQLLVELETPKAVALDCLAFAGRGY 137
            |.|.:..:|.| .:|.|.::.|..    |:|.|...: ..||   .:.|.:|.:........:.:
  Rat   322 LGIEVFNIPGVGLFAAAANRKARS----AIYKWSDGKFVSYQ---NIATHQAQSWRHFTIGKKIF 379

  Fly   138 VAVSYNLTEPVSQAREGSPIYEISPETGIRTVQYFSGTHLRGMYLRISSQELTLLHAFESNAQCP 202
            :||: |. .|..:.:|.|.||:.||    |.:::                  ||           
  Rat   380 LAVA-NF-GPNERGQEFSVIYKWSP----RKLKF------------------TL----------- 409

  Fly   203 YFKWMGKSFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQRFQLF 267
                    :||: |.|  .||..|||.:|...::.|||:.:.:... ..|.::||:..||.|:..
  Rat   410 --------YQRI-ATH--SARDWEAFEVDGEHFLVVANHREGDNHN-IDSVVYRWNPSSQLFEAN 462

  Fly   268 QRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQR-LSFY 331
            |.:.::||.|.::|:     |....||::.||..||..:|   .:.:|::..|.|..:|. |:|.
  Rat   463 QSIATSGAYDWEFFT-----VGPYSFLVVANTFNGTSTQV---HSHLYIWLVGAFQLFQSFLTFG 519

  Fly   332 ALERVLPVQHSISEKFLLLVA-CNKQDVK-------------IYNLN------------------ 364
            |.:  ..|.| |.|:..|.|| .:..||:             ||.||                  
  Rat   520 AAD--WEVFH-IGERIFLAVANSHSYDVQMQAQNDTYILSSVIYELNVTAQTFVKFQDIPTCSAL 581

  Fly   365 DWRFEESKVQFTEGALSRGVARMRSYEEGDQSYLVIANENMAANETNIFQPLYKQDEHANILRQQ 429
            ||.|                     :..|:..:||:|| :...|..::...:|:...:...:...
  Rat   582 DWEF---------------------FSVGEDHFLVVAN-SFDGNTFSVNSIIYRWQGYEGFVAVH 624

  Fly   430 II------DW---------------AREQRKRLEQMNLD 447
            .:      ||               |:|...|:.::..|
  Rat   625 KLPTFGCRDWEAFNTTAGSYLIYSSAKEPLSRVLKLRTD 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 14/52 (27%)
TspearXP_017443498.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304499604
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15261
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.990

Return to query results.
Submit another query.