DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: clos and Tspear

Sequence 1:NP_001097246.3 Gene:clos FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster
Sequence 2:NP_001274003.1 Gene:Tspear MGIID:2671932 Length:670 Species:Mus musculus

Alignment Length:455 Identity:100/456 (22%)
Similarity:170/456 (37%) Gaps:159/456 (35%)


  Fly    28 SYPTHFLNSDQESMLHKRATAVPQFFDQASFSFD----------GLERVASVPVSFPLDICILQL 82
            :||   ..:|.:..|..|......  :.|.|.||          |.|.|:.:.....||.     
Mouse   261 NYP---YEADMKVTLGSRPPCTKA--EGAQFWFDAAQKGLYLCAGSEWVSVLAAKTKLDY----- 315

  Fly    83 PTVKYATALHKNAAGVRHFAVYTWRPAEQDYQLLVELETPKAVALDCLAFAGRGYVAVSYNLTEP 147
              |:...:||.|:                           :.:.::..:..|.|..|.:.|    
Mouse   316 --VEEHQSLHTNS---------------------------ETLGIEVFSIPGVGLFAAAAN---- 347

  Fly   148 VSQAREGSPIYE------ISPETGIRTVQYFSGTHL---RGMYLRISS-------QELTLLHAFE 196
             .:||  |.||:      :|.: .|.|.|..|..|.   :.::|.:::       ||.:::    
Mouse   348 -RKAR--SAIYKWTDGKFVSYQ-NIATHQAQSWRHFTIGKKIFLAVANFGPNERGQEFSVI---- 404

  Fly   197 SNAQCPYFKWMGKS-----FQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFR 256
                   :||..:.     :||: |.|  .||..|||.:|...::.|||:.:.:... ..|.::|
Mouse   405 -------YKWSPRKLKFTLYQRI-ATH--SARDWEAFEVDGEHFLVVANHREGDNHN-IDSMVYR 458

  Fly   257 WDAKSQRFQLFQRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQ 321
            |:..||.|:..|.:.::||.|.::|:     |....||::.||..||..:|   .:.:|::..|.
Mouse   459 WNPSSQLFEANQSIATSGAYDWEFFT-----VGPYSFLVVANTFNGTSTQV---HSHLYIWLVGA 515

  Fly   322 FVPYQR-LSFYALERVLPVQHSISEKFLLLVA-CNKQDVK-------------IYNLN------- 364
            |..:|. |:|.|.:  ..|.| |.|:..|.|| .:..||:             ||.||       
Mouse   516 FQLFQSFLTFGAAD--WEVFH-IGERIFLAVANSHSYDVQMQAQNDSYVLSSVIYELNITAQTFV 577

  Fly   365 -----------DWRFEESKVQFTEGALSRGVARMRSYEEGDQSYLVIANENMAANETNIFQPLYK 418
                       ||.|                     :..|:..:||:|| :...|..::...:|:
Mouse   578 KFQDIPTCSALDWEF---------------------FSVGEDHFLVVAN-SFDGNTFSVNSIIYR 620

  Fly   419  418
            Mouse   621  620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
closNP_001097246.3 EPTP 263..315 CDD:281697 14/52 (27%)
TspearNP_001274003.1 LamG <84..223 CDD:304605
EAR 1. {ECO:0000255|PROSITE-ProRule:PRU00075} 314..359 14/86 (16%)
EAR 2. {ECO:0000255|PROSITE-ProRule:PRU00075} 361..409 11/60 (18%)
EPTP 361..408 CDD:281697 11/59 (19%)
EAR 3. {ECO:0000255|PROSITE-ProRule:PRU00075} 413..461 16/52 (31%)
EPTP 413..460 CDD:281697 16/51 (31%)
EAR 4. {ECO:0000255|PROSITE-ProRule:PRU00075} 465..513 15/56 (27%)
EPTP 466..511 CDD:281697 15/53 (28%)
EAR 5. {ECO:0000255|PROSITE-ProRule:PRU00075} 515..571 18/59 (31%)
EPTP 516..>546 CDD:281697 12/33 (36%)
EAR 6. {ECO:0000255|PROSITE-ProRule:PRU00075} 575..623 10/69 (14%)
EPTP 576..621 CDD:281697 10/68 (15%)
EAR 7. {ECO:0000255|PROSITE-ProRule:PRU00075} 626..669
EPTP 626..666 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304494599
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005836
OrthoInspector 1 1.000 T1082357
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15261
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4919
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.