DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and AT2G01090

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001189492.1 Gene:AT2G01090 / 814638 AraportID:AT2G01090 Length:62 Species:Arabidopsis thaliana


Alignment Length:61 Identity:21/61 - (34%)
Similarity:31/61 - (50%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVS 77
            |||:||.:....|.|:.| .::.|. :||.|..|:.......:.|..:.|||...:|.|||
plant     3 EEDVVDQKRYFEESCKPK-CVKPLL-EYQACVKRIQDDESGHKHCTGQYFDYWHCVDKCVS 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 17/56 (30%)
AT2G01090NP_001189492.1 UCR_hinge 8..61 CDD:396756 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4736
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2651
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - LDO PTHR15336
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.