powered by:
Protein Alignment UQCR-11 and AT2G01090
DIOPT Version :9
Sequence 1: | NP_001104407.2 |
Gene: | UQCR-11 / 5740185 |
FlyBaseID: | FBgn0260008 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189492.1 |
Gene: | AT2G01090 / 814638 |
AraportID: | AT2G01090 |
Length: | 62 |
Species: | Arabidopsis thaliana |
Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
Similarity: | 31/61 - (50%) |
Gaps: | 2/61 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVS 77
|||:||.:....|.|:.| .::.|. :||.|..|:.......:.|..:.|||...:|.|||
plant 3 EEDVVDQKRYFEESCKPK-CVKPLL-EYQACVKRIQDDESGHKHCTGQYFDYWHCVDKCVS 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I4736 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4763 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
48 |
1.000 |
Inparanoid score |
I2651 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102683 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15336 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.950 |
|
Return to query results.
Submit another query.