DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and Uqcrh

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_079917.1 Gene:Uqcrh / 66576 MGIID:1913826 Length:89 Species:Mus musculus


Alignment Length:73 Identity:31/73 - (42%)
Similarity:46/73 - (63%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVS 77
            :.::||:||||...:||.|:..........:.:.|::||:.||:|.|.|.|||||::...||||:
Mouse    17 KEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVA 81

  Fly    78 HSLFTKLK 85
            |.||..||
Mouse    82 HKLFKNLK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 25/61 (41%)
UqcrhNP_079917.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 4/9 (44%)
UCR_hinge 26..89 CDD:396756 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849556
Domainoid 1 1.000 63 1.000 Domainoid score I10209
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5274
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52039
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm43165
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - LDO PTHR15336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.