powered by:
Protein Alignment UQCR-11 and T27E9.2
DIOPT Version :9
Sequence 1: | NP_001104407.2 |
Gene: | UQCR-11 / 5740185 |
FlyBaseID: | FBgn0260008 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499781.1 |
Gene: | T27E9.2 / 176772 |
WormBaseID: | WBGene00012094 |
Length: | 75 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 33/72 - (45%) |
Similarity: | 38/72 - (52%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EEDL---VDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSH 78
||.| ||.....||:| ..|:....:...|||||||.||.|.|||.:|:.|||..||||...
Worm 6 EEPLEADVDQLTQYRERC--ADHVTEFKSILDECNDRVNSRSNTEETCHQEMADYVHHLDHCAMP 68
Fly 79 SLFTKLK 85
..|..||
Worm 69 KAFASLK 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I7070 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4763 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
61 |
1.000 |
Inparanoid score |
I3999 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG52039 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005545 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14273 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102683 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15336 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
11 | 10.830 |
|
Return to query results.
Submit another query.