DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and T27E9.2

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_499781.1 Gene:T27E9.2 / 176772 WormBaseID:WBGene00012094 Length:75 Species:Caenorhabditis elegans


Alignment Length:72 Identity:33/72 - (45%)
Similarity:38/72 - (52%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEDL---VDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSH 78
            ||.|   ||.....||:|  ..|:....:...|||||||.||.|.|||.:|:.|||..||||...
 Worm     6 EEPLEADVDQLTQYRERC--ADHVTEFKSILDECNDRVNSRSNTEETCHQEMADYVHHLDHCAMP 68

  Fly    79 SLFTKLK 85
            ..|..||
 Worm    69 KAFASLK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 27/61 (44%)
T27E9.2NP_499781.1 UCR_hinge 14..74 CDD:280480 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7070
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I3999
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52039
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm14273
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - LDO PTHR15336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.