DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11 and AgaP_AGAP002245

DIOPT Version :9

Sequence 1:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster
Sequence 2:XP_307940.5 Gene:AgaP_AGAP002245 / 1269317 VectorBaseID:AGAP002245 Length:87 Species:Anopheles gambiae


Alignment Length:87 Identity:54/87 - (62%)
Similarity:65/87 - (74%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFRNWFS--LPAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIE 63
            ||.|.|||  .|.|:|.:|||:||||.||||||...|....|:.|||.||:||..||:|.|||:|
Mosquito     1 MAARKWFSSFFPTVKAQEEEDIVDPQTVLREKCAQHGSAPQLWEKYQACNERVGSRSQTAETCVE 65

  Fly    64 ELFDYVAELDHCVSHSLFTKLK 85
            |||||:.||||||:.:||:|||
Mosquito    66 ELFDYLHELDHCVTKTLFSKLK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 38/61 (62%)
AgaP_AGAP002245XP_307940.5 UCR_hinge 24..86 CDD:280480 38/61 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I13967
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I7172
OMA 1 1.010 - - QHG52039
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm50241
Panther 1 1.100 - - LDO PTHR15336
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4498
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.