DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34215 and CG14132

DIOPT Version :10

Sequence 1:NP_001097204.1 Gene:CG34215 / 5740170 FlyBaseID:FBgn0085244 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001097586.1 Gene:CG14132 / 50290 FlyBaseID:FBgn0040817 Length:118 Species:Drosophila melanogaster


Alignment Length:102 Identity:29/102 - (28%)
Similarity:43/102 - (42%) Gaps:22/102 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AAIAVLLV--SGYEAAVVR--GVFEDPTHPGKCV--LEGLVLEKGQSARHPQRCERIICG-ENSA 66
            ||||::.:  |..:||:..  .:|. |.|||||.  |....|...:..:....|..:.|. |...
  Fly     8 AAIALIAIFASVVDAAIYSQPAIFH-PAHPGKCFDKLTRKALLPDKEYKPKGICAAMTCSLEALE 71

  Fly    67 AEIQSC------GAYGLPPGKKFGKYTNPNADYPDCC 97
            ..|::|      |...||        ::||..:|.||
  Fly    72 ISIETCPYVEAPGCEELP--------SDPNWRFPKCC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34215NP_001097204.1 SVWC 37..99 CDD:464713 16/70 (23%)
CG14132NP_001097586.1 SVWC 48..105 CDD:464713 14/61 (23%)

Return to query results.
Submit another query.