DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34215 and CG14132

DIOPT Version :9

Sequence 1:NP_001097204.1 Gene:CG34215 / 5740170 FlyBaseID:FBgn0085244 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001097586.1 Gene:CG14132 / 50290 FlyBaseID:FBgn0040817 Length:118 Species:Drosophila melanogaster


Alignment Length:102 Identity:29/102 - (28%)
Similarity:43/102 - (42%) Gaps:22/102 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AAIAVLLV--SGYEAAVVR--GVFEDPTHPGKCV--LEGLVLEKGQSARHPQRCERIICG-ENSA 66
            ||||::.:  |..:||:..  .:|. |.|||||.  |....|...:..:....|..:.|. |...
  Fly     8 AAIALIAIFASVVDAAIYSQPAIFH-PAHPGKCFDKLTRKALLPDKEYKPKGICAAMTCSLEALE 71

  Fly    67 AEIQSC------GAYGLPPGKKFGKYTNPNADYPDCC 97
            ..|::|      |...||        ::||..:|.||
  Fly    72 ISIETCPYVEAPGCEELP--------SDPNWRFPKCC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34215NP_001097204.1 SVWC 37..99 CDD:292070 16/70 (23%)
CG14132NP_001097586.1 SVWC 48..105 CDD:292070 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.