DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34454 and CG34453

Sequence 1:NP_001097457.1 Gene:CG34454 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001097458.2 Gene:CG34453 FlyBaseID:FBgn0085482 Length:175 Species:Drosophila melanogaster

Alignment Length:75 Identity:15/76 (20%)
Similarity:23/76 (30%) Gaps:22/76 (29%)


  Fly    50 NLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCPTTSQYNPICGSNMQLYMNEEKFNCARFCGA 114
            |..|.|.:::. .|.|||........|:       :...|.|:...            |.  ||.
  Fly    46 NSQLSNQLKLK-DLCPFVHNNQGESRFV-------SPEMYKPLLAV------------CR--CGR 88

  Fly   115 DIQIVRRGSC 124
            ..:.:..|.|
  Fly    89 TKESIHMGKC 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 7/26 (27%)
KAZAL_FS 78..124 CDD:294071 6/46 (13%)
CG34453NP_001097458.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134462991
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.